Clone Name | baet99f05 |
---|---|
Clone Library Name | barley_pub |
>VPA_BPP2 (Q06419) Replication gene A protein (GpA)| Length = 761 Score = 32.7 bits (73), Expect = 0.45 Identities = 19/53 (35%), Positives = 23/53 (43%), Gaps = 7/53 (13%) Frame = -1 Query: 427 HHGVWHWHFRLLCHLRHNR-----MREFRLRELGHSR--VRRQFVLWHLGHHG 290 H G HWH L C+ R MR + L+E G R R +F HL G Sbjct: 394 HDGTPHWHMMLFCNPRQRNQIIEIMRRYALKEDGDERGAARNRFQAKHLNQGG 446
>KR413_HUMAN (Q9BYU7) Keratin-associated protein 4-13 (Keratin-associated| protein 4.13) (Ultrahigh sulfur keratin-associated protein 4.13) Length = 106 Score = 32.3 bits (72), Expect = 0.58 Identities = 21/59 (35%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = +3 Query: 264 TLSSPKCHTPWCPR---CQSTNCRRTLLCPSSRSLNSRIRLCLRWQRSLKCQCHTPWCR 431 T P C P C R CQS C+ T CPS + C R Q +C T CR Sbjct: 34 TCCRPSCCRPSCCRPQCCQSVCCQPTCCCPS-----YCVSSCCRPQCCQTTRCRTTCCR 87
>KRA44_HUMAN (Q9BYR3) Keratin-associated protein 4-4 (Keratin-associated protein| 4.4) (Ultrahigh sulfur keratin-associated protein 4.4) Length = 166 Score = 30.8 bits (68), Expect = 1.7 Identities = 20/56 (35%), Positives = 22/56 (39%) Frame = +3 Query: 264 TLSSPKCHTPWCPRCQSTNCRRTLLCPSSRSLNSRIRLCLRWQRSLKCQCHTPWCR 431 T P C P C CQS C+ T CPS + C R Q C T CR Sbjct: 99 TCCRPSCCRPQC--CQSVCCQPTCCCPS-----YCVSSCCRPQCCQTTCCRTTCCR 147 Score = 28.5 bits (62), Expect = 8.4 Identities = 24/65 (36%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Frame = +3 Query: 264 TLSSPKCHTPWC--PRCQSTNCRRTLLCPSSRSLNSRIRLCLRWQ--RSLKCQ--CHTPW 425 T P C C P+C T C RT C S ++S C R Q +S+ CQ C P Sbjct: 34 TCCRPSCCVSSCCRPQCCQTTCCRTTCCHPSCCVSS----CCRPQCCQSVCCQPTCCRPQ 89 Query: 426 CRRCQ 440 C CQ Sbjct: 90 C--CQ 92
>NUP98_HUMAN (P52948) Nuclear pore complex protein Nup98-Nup96 precursor| [Contains: Nuclear pore complex protein Nup98 (Nucleoporin Nup98) (98 kDa nucleoporin); Nuclear pore complex protein Nup96 (Nucleoporin Nup96) (96 kDa nucleoporin)] Length = 1729 Score = 30.0 bits (66), Expect = 2.9 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 451 AARAWHLRHHGVWHWHFRLLCHLRHNRMREFRLREL 344 A+ A L G+W W +L H+ ++ +RE +REL Sbjct: 1550 ASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVREL 1585
>KR415_HUMAN (Q9BYQ5) Keratin-associated protein 4-15 (Keratin-associated| protein 4.15) (Ultrahigh sulfur keratin-associated protein 4.15) (Fragment) Length = 193 Score = 29.6 bits (65), Expect = 3.8 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = +3 Query: 282 CHTPWCPRCQSTNCRRTLLCPSSRSLNSRIRLCLRWQ--RSLKCQ--CHTPWC 428 C CP C T C RT C S ++S C R Q +S+ CQ C P C Sbjct: 49 CRPSCCPSCCQTTCCRTTCCRPSCCVSS----CCRPQCCQSVCCQPTCCRPSC 97
>HSPC_ELECI (P83183) Cysteine-rich protamine| Length = 84 Score = 28.9 bits (63), Expect = 6.4 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 5/64 (7%) Frame = +3 Query: 270 SSPKCHTPWCPRCQSTNCRRTLLC--PSSRSLNS---RIRLCLRWQRSLKCQCHTPWCRR 434 S P+C PRC+S + +R C SR + R C R +R C C R Sbjct: 4 SKPRCRPRCKPRCRSRSKKRCRRCRRRCSRIVKKCCRRRSKCCRRRRRCPCPCPRKKLRC 63 Query: 435 CQAR 446 C+ R Sbjct: 64 CKRR 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.133 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,531,499 Number of Sequences: 219361 Number of extensions: 728654 Number of successful extensions: 2003 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1987 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)