ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf101c04 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os11g11480:12011.t01035:unspliced-genomic hypothetical protein| Length = 715 Score = 42.8 bits (87), Expect = 7e-04 Identities = 19/44 (43%), Positives = 21/44 (47%) Frame = -3 / +1 Query: 134 KDSDTHRRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 + D RR GA V A W WRR +R G R RA RRR Sbjct: 544 RGGDRRRRAGSGGAGTVLEAALAWCWRRCRRGGGRRRRADRRRR 675
>LOC_Os10g38740:12010.t03114:unspliced-genomic glutathione S-transferase GSTU6, putative, expressed| Length = 1643 Score = 40.5 bits (82), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +2 / +2 Query: 2 DDADKMLDFLPTLLAWIASKAK* 70 DDADK+L+F TLL W ASKAK* Sbjct: 1301 DDADKLLEFRQTLLRWSASKAK* 1369 Score = 31.8 bits (63), Expect = 1.5 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -3 / -1 Query: 95 ADDVTAARFTWPWRRSKRAGWARSRASCRR 6 A V + T W RS AG A +RA+CRR Sbjct: 1394 AKTVVSCHLTLLWMRSSEAGSA*TRAACRR 1305 Score = 31.3 bits (62), Expect = 2.1 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -2 / -3 Query: 69 HLALEAIQASRVGKKSSILSASS 1 H AL+A+Q SRV SS LSASS Sbjct: 1368 HFALDALQRSRVCLNSSSLSASS 1300
>LOC_Os09g37790:12009.t03253:unspliced-genomic S-locus-specific glycoprotein S13 precursor, putative, expressed| Length = 5581 Score = 40.0 bits (81), Expect = 0.005 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -3 / -1 Query: 83 TAARFTWPWRRSKRAGWARSRASCRRR 3 TA R W RR +R GW + RASCRR+ Sbjct: 4159 TARRSPWRRRRHRRRGWRQGRASCRRQ 4079
>LOC_Os05g31140:12005.t02711:unspliced-genomic lichenase-2 precursor, putative, expressed| Length = 4762 Score = 35.9 bits (72), Expect(2) = 0.008 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 / -2 Query: 77 ARFTWPWRRSKRAGWARSRASCRRR 3 +R WPWRR R W R+ + RRR Sbjct: 4038 SRRAWPWRRRTRRRWCRTGSGTRRR 3964 Score = 24.0 bits (46), Expect(2) = 0.008 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 / -2 Query: 157 YIYSTHNERTQTHTDEHTCQE 95 Y+Y+T T THT + C E Sbjct: 4356 YVYTTLPAVTYTHTYAYMCTE 4294
>LOC_Os03g46570:12003.t04025:unspliced-genomic ubiquitin-protein ligase/ zinc ion binding protein, putative,| expressed Length = 1341 Score = 38.6 bits (78), Expect = 0.013 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 / +2 Query: 80 AARFTWPWRRSKRAGWARSRASC 12 A R TWPWRR + W+ S ASC Sbjct: 437 APRATWPWRRRLASSWSTSTASC 505
>LOC_Os04g41759:12004.t005525:unspliced-genomic expressed protein| Length = 1553 Score = 38.2 bits (77), Expect = 0.018 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 / +3 Query: 101 PGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 P T AR WPWRR++R R R S R R Sbjct: 1185 PSGTRATGARIRWPWRRTRRGPRPRCRTSRRAR 1283
>LOC_Os02g45810:12002.t04168:unspliced-genomic transparent testa glabra 1 protein, putative, expressed| Length = 3101 Score = 36.8 bits (74), Expect = 0.046 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = -3 / -1 Query: 77 ARFTWPWRRSKRAGWARSRASCRRR 3 AR W WRR +RAG AR+ A RRR Sbjct: 572 ARRRWRWRRDRRAGQARAAARRRRR 498
>LOC_Os01g56680:12001.t05078:unspliced-genomic photosystem II reaction center W protein, chloroplast precursor,| putative, expressed Length = 1464 Score = 35.9 bits (72), Expect = 0.087 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -3 / +1 Query: 77 ARFTWPWRRSKRAGWARSRASCRRR 3 AR W WRR +R W S CRRR Sbjct: 352 ARRYWRWRRRRRPRWRSSTRGCRRR 426
>LOC_Os01g56670:12001.t05077:unspliced-genomic ER degradation-enhancing alpha-mannosidase-like 1, putative,| expressed Length = 10248 Score = 35.9 bits (72), Expect = 0.087 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -3 / -2 Query: 77 ARFTWPWRRSKRAGWARSRASCRRR 3 AR W WRR +R W S CRRR Sbjct: 9920 ARRYWRWRRRRRPRWRSSTRGCRRR 9846
>LOC_Os12g06780:12012.t00563:unspliced-genomic expressed protein| Length = 1590 Score = 35.4 bits (71), Expect = 0.12 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -3 / +3 Query: 116 RRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRR 6 RR A A TWP RR++R W RS A RR Sbjct: 135 RRPSPSAAPSSLCAATTWPCRRARRPTWRRSSAISRR 245
>LOC_Os05g46340:12005.t04122:unspliced-genomic expressed protein| Length = 1885 Score = 35.4 bits (71), Expect = 0.12 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 / +3 Query: 74 RFTWPWRRSKRAGWARSRAS 15 R W WRR +R GWAR R S Sbjct: 552 RDRWTWRRRRRRGWARGRRS 611
>LOC_Os04g02510:12004.t00144:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 3785 Score = 28.6 bits (56), Expect(2) = 0.14 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 / -3 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR R GW R+ RRR Sbjct: 570 WRRRPRRGWRRATRRTRRR 514 Score = 26.7 bits (52), Expect(2) = 0.14 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 / -2 Query: 169 HCMWYIYSTHNERTQ 125 H W IYSTH R+Q Sbjct: 1195 HIDWAIYSTHTRRSQ 1151
>LOC_Os10g40559:12010.t03295:unspliced-genomic xyloglucan galactosyltransferase KATAMARI 1, putative, expressed| Length = 1588 Score = 35.0 bits (70), Expect = 0.16 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -3 / -2 Query: 95 ADDVTAARFTWPWRRSKRAGWARSRAS 15 AD + +++WPWRR++ G +R+R S Sbjct: 597 ADPASTRKWSWPWRRARICGLSRARNS 517
>LOC_Os09g38470:12009.t03315:unspliced-genomic hypothetical protein| Length = 4219 Score = 35.0 bits (70), Expect = 0.16 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 / -1 Query: 62 PWRRSKRAGWARSRASCRRR 3 PWRR++R W +R CRRR Sbjct: 280 PWRRTRRGRWQGTRRRCRRR 221
>LOC_Os04g53690:12004.t04843:unspliced-genomic expressed protein| Length = 3379 Score = 35.0 bits (70), Expect = 0.16 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -3 / -1 Query: 119 HRRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 HR+TH D + R TW R + R R+RAS RRR Sbjct: 409 HRKTHARHGGDHRSERQTWRSRSNGRRSE*RARASTRRR 293
>LOC_Os03g54130:12003.t04728:unspliced-genomic cysteine protease 1 precursor, putative, expressed| Length = 1835 Score = 35.0 bits (70), Expect = 0.16 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 / +3 Query: 74 RFTWPWRRSKRAGWARSRASCRRR 3 R TWPWRR R+GW + R R Sbjct: 156 RPTWPWRRGTRSGWRSTGRRTRTR 227
>LOC_Os11g09040:12011.t00796:unspliced-genomic expressed protein| Length = 1218 Score = 34.5 bits (69), Expect = 0.22 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -3 / +1 Query: 77 ARFTWPWRRSKRAGWARSRASCRRR 3 AR+ WPWRRS R+ A SR+ R R Sbjct: 544 ARWRWPWRRSTRSSTAASRSWRRWR 618
>LOC_Os11g04400:12011.t00333:unspliced-genomic scarecrow-like protein, putative| Length = 2676 Score = 34.5 bits (69), Expect = 0.22 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 / +1 Query: 80 AARFTWPWRRSKRAGWARSRASCRR 6 A R WP RR+ AGW+R R S RR Sbjct: 1648 AWRRVWPARRAWSAGWSRPRRSARR 1722
>LOC_Os05g25390:12005.t02195:unspliced-genomic protein kinase, putative, expressed| Length = 4515 Score = 34.5 bits (69), Expect = 0.22 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 / +2 Query: 113 RTHMPGADDVTAARFTWPWRRSKRAGWARSRAS 15 R GA DV A WPWRR + G AR+ S Sbjct: 3890 RCRAVGASDVQARH*LWPWRRRCQLGRARATGS 3988
>LOC_Os09g03090:12009.t00208:unspliced-genomic expressed protein| Length = 6115 Score = 29.5 bits (58), Expect(2) = 0.25 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 / +2 Query: 71 FTWPWRRSKRAGWARSRASC 12 F+W WRR A ++ S +SC Sbjct: 3458 FSWSWRRGSNATFSSSSSSC 3517 Score = 22.1 bits (42), Expect(2) = 0.25 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 / +1 Query: 184 AHGRTHCMWYIYSTHNERTQTHTDEHTCQEQTMSR 80 +H HC+ + T+ + + H C Q MS+ Sbjct: 3274 SHWSLHCLKFNNITYKSSLISSSVRHACCMQHMSQ 3378
>LOC_Os04g27980:12004.t02499:unspliced-genomic acidic endochitinase precursor, putative, expressed| Length = 1622 Score = 34.1 bits (68), Expect = 0.31 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -3 / -3 Query: 83 TAARFTWPWRRSKRAGWARSRASCRR 6 T A TW RRS R G AR R+ CRR Sbjct: 582 TVALGTWRGRRSGRGGRARCRSRCRR 505
>LOC_Os03g13370:12003.t01131:unspliced-genomic cell division cycle protein 16, putative, expressed| Length = 9825 Score = 34.1 bits (68), Expect = 0.31 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 / +2 Query: 101 PGADDVTAARFTWPWRRSKRAGWARSRA 18 P T+ F WP RR R GWA SRA Sbjct: 257 PPPPPTTSPPFPWPRRRRLRDGWAASRA 340
>LOC_Os04g20540:12004.t01791:unspliced-genomic hydroquinone glucosyltransferase, putative, expressed| Length = 1477 Score = 34.1 bits (68), Expect = 0.31 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -2 / +1 Query: 195 QHRLPMVGHTACGTFIQHTMKGLRHTQTNTHARSRRCHG 79 +HR + GH A G H ++ +H T HA +RR G Sbjct: 814 RHRAALDGHAAAGIRAVHLVRHQQHDTTRAHAGARRGAG 930
>LOC_Os09g38480:12009.t03316:unspliced-genomic hypothetical protein| Length = 1808 Score = 33.6 bits (67), Expect = 0.42 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 / -2 Query: 62 PWRRSKRAGWARSRASCRRR 3 PWRR++R W +R CRRR Sbjct: 280 PWRRTRRGRW*GTRRRCRRR 221
>LOC_Os06g12350:12006.t01112:unspliced-genomic amino acid transporter, putative, expressed| Length = 4003 Score = 27.2 bits (53), Expect(2) = 0.47 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 / -2 Query: 147 QHTMKGLRHTQTNTHARSRRCHGR 76 +H + H + H R R+CHGR Sbjct: 3573 RHRRRRHDHRRPQRHPRRRQCHGR 3502 Score = 26.3 bits (51), Expect(2) = 0.47 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 / -2 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR R W +R + RRR Sbjct: 2589 WRRRGRGRWRSTRTTSRRR 2533
>LOC_Os12g40310:12012.t03710:unspliced-genomic retrotransposon protein, putative, SINE subclass| Length = 2206 Score = 33.1 bits (66), Expect = 0.58 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 / -1 Query: 62 PWRRSKRAGWARSRASCRRR 3 PWRR +R A RA CRRR Sbjct: 166 PWRRRRRVAPATGRAGCRRR 107
>LOC_Os11g07470:12011.t00638:unspliced-genomic expressed protein| Length = 7076 Score = 33.1 bits (66), Expect = 0.58 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 / +2 Query: 110 THMPGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 +H+P AAR+T WRRS+ R+R RRR Sbjct: 59 SHLPHLRRSPAARWTSSWRRSRPT*GRRTRCGSRRR 166
>LOC_Os10g36580:12010.t02937:unspliced-genomic expressed protein| Length = 1154 Score = 33.1 bits (66), Expect = 0.58 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 / +2 Query: 65 WPWRRSKRAGWARSRASCRRR 3 W WRR +R+G A S AS RRR Sbjct: 614 WRWRRRRRSGCACSSASWRRR 676
>LOC_Os08g42020:12008.t03931:unspliced-genomic expressed protein| Length = 2562 Score = 33.1 bits (66), Expect = 0.58 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 / -1 Query: 68 TWPWRRSKRAGWARSRASCRRR 3 TWPWR +R W R R R R Sbjct: 405 TWPWRAPRRRRWGRGRGGRRWR 340
>LOC_Os01g08420:12001.t00720:unspliced-genomic EMB2410, putative, expressed| Length = 6930 Score = 33.1 bits (66), Expect = 0.59 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -1 / -2 Query: 160 WYIYSTHNERTQTHTDEHTCQEQTMSRPHGSL 65 W I + +N++T+ H+CQ+ T + H +L Sbjct: 953 WQISNLYNKKTRIEKIRHSCQQSTSKQDHNAL 858
>LOC_Os02g06480:12002.t00546:unspliced-genomic protein SCO1, mitochondrial precursor, putative, expressed| Length = 6427 Score = 28.1 bits (55), Expect(2) = 0.61 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 / +2 Query: 80 AARFTWPWRRSKRAGWARSRAS 15 AA + PWRR +RAG R R + Sbjct: 5828 AAPWRRPWRRGRRAGTRRRRGA 5893 Score = 22.1 bits (42), Expect(2) = 0.61 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 / +2 Query: 29 RSRASCRRR 3 RSR SCRRR Sbjct: 5972 RSRGSCRRR 5998
>LOC_Os02g06470:12002.t00545:unspliced-genomic F-box domain containing protein, expressed| Length = 1863 Score = 28.1 bits (55), Expect(2) = 0.66 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 / -1 Query: 80 AARFTWPWRRSKRAGWARSRAS 15 AA + PWRR +RAG R R + Sbjct: 600 AAPWRRPWRRGRRAGTRRRRGA 535 Score = 22.1 bits (42), Expect(2) = 0.66 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 / -1 Query: 29 RSRASCRRR 3 RSR SCRRR Sbjct: 456 RSRGSCRRR 430
>LOC_Os02g33890:12002.t03030:unspliced-genomic hypothetical protein| Length = 2508 Score = 29.9 bits (59), Expect(2) = 0.77 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 / -3 Query: 65 WPWRRSKRAGWARSRASCRRR 3 W R S+RAG AR+R S RRR Sbjct: 1531 WRRRTSRRAGTARARRSRRRR 1469 Score = 22.1 bits (42), Expect(2) = 0.77 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 / -1 Query: 100 QEQTMSRPHGSLGLGGD 50 +E R G LGLGGD Sbjct: 1821 EEGLEGRDDGHLGLGGD 1771
>LOC_Os10g39160:12010.t03159:unspliced-genomic peroxidase 2 precursor, putative| Length = 1127 Score = 32.7 bits (65), Expect = 0.80 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / -3 Query: 59 WRRSKRAGWARSRASCRRR 3 WR R+ W RSR CRRR Sbjct: 942 WRARWRSSWCRSRTRCRRR 886
>LOC_Os10g02000:12010.t00095:unspliced-genomic acyl transferase, putative| Length = 1143 Score = 32.7 bits (65), Expect = 0.80 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 / +2 Query: 83 TAARFTWPWRRSKR 42 TAAR TWPWRR+ R Sbjct: 722 TAARCTWPWRRAAR 763
>LOC_Os10g01930:12010.t00089:unspliced-genomic acyltransferase, putative, expressed| Length = 1344 Score = 32.7 bits (65), Expect = 0.80 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 / +2 Query: 83 TAARFTWPWRRSKR 42 TAAR TWPWRR+ R Sbjct: 908 TAARCTWPWRRAAR 949
>LOC_Os09g29300:12009.t02608:unspliced-genomic clathrin assembly protein, putative, expressed| Length = 1002 Score = 32.7 bits (65), Expect = 0.80 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 / -3 Query: 68 TWPWRRSKRAGWARSRASCRRR 3 TWP RR RAG R+R C RR Sbjct: 421 TWPRRRIGRAGRRRARGGCGRR 356
>LOC_Os09g26690:12009.t02348:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 3016 Score = 32.7 bits (65), Expect = 0.80 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 / +1 Query: 80 AARFTWPWRRSKRAGWARSRASCRRR 3 A + WPWRR G R +CRRR Sbjct: 265 AKKSIWPWRRLVAEGVHRRHTACRRR 342
>LOC_Os03g60340:12003.t05272:unspliced-genomic expressed protein| Length = 3720 Score = 32.7 bits (65), Expect = 0.80 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 / +3 Query: 83 TAARFTWPWRRSKRAGWARSR 21 T AR +W WRR +R GW +R Sbjct: 2784 T*ARTSWRWRRRRRTGWCCTR 2846
>LOC_Os01g19430:12001.t01733:unspliced-genomic Werner syndrome ATP-dependent helicase, putative, expressed| Length = 843 Score = 32.7 bits (65), Expect = 0.80 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 / -1 Query: 62 PWRRSKRAGWARSRASCRR 6 PWR S+R GWA +R+ RR Sbjct: 231 PWRSSRRRGWASTRSRGRR 175
>LOC_Os08g16940:12008.t01565:unspliced-genomic zinc finger, C2H2 type family protein, expressed| Length = 2162 Score = 29.5 bits (58), Expect(2) = 0.90 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 / -2 Query: 101 PGADDVTAARFTWPWRRSKR 42 P A + AA +WPWRR+ R Sbjct: 1048 PAASRLAAASASWPWRRACR 989 Score = 22.1 bits (42), Expect(2) = 0.90 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 / -2 Query: 56 RRSKRAGWARSRASCRRR 3 RRS R WA +S RRR Sbjct: 643 RRSGRRPWASCYSSRRRR 590
>LOC_Os12g09200:12012.t00799:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2568 Score = 32.2 bits (64), Expect = 1.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 / -3 Query: 80 AARFTWPWRRSKRAGWARSRASCRR 6 A R+TW W+R W R+ +CRR Sbjct: 1465 ARRWTWWWKRMPAGVW*RTPGACRR 1391
>LOC_Os08g39980:12008.t03729:unspliced-genomic DNA binding protein, putative, expressed| Length = 3367 Score = 32.2 bits (64), Expect = 1.1 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -3 / +2 Query: 98 GADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 G V + W WRRS R W + R RRR Sbjct: 1973 GRGTVARSGAMWTWRRSGRGWWVQRRRRRRRR 2068
>LOC_Os07g10150:12007.t00889:unspliced-genomic coatomer subunit gamma, putative, expressed| Length = 7389 Score = 32.2 bits (64), Expect = 1.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 / -1 Query: 74 RFTWPWRRSKRAGWARSRASCR 9 RFTW RR+ G ++RASCR Sbjct: 621 RFTWQQRRASSCGSWKTRASCR 556
>LOC_Os06g05272:12006.t00416:unspliced-genomic pectate lyase precursor, putative| Length = 1145 Score = 32.2 bits (64), Expect = 1.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 / -2 Query: 74 RFTWPWRRSKRAGWARSRASCRRR 3 R +W WRR + W R+ CRRR Sbjct: 517 RSSWTWRRGRSRCWRRT*WRCRRR 446
>LOC_Os06g05209:12006.t00410:unspliced-genomic pectate lyase precursor, putative, expressed| Length = 1759 Score = 32.2 bits (64), Expect = 1.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 / -3 Query: 74 RFTWPWRRSKRAGWARSRASCRRR 3 R +W WRR + W R+ CRRR Sbjct: 977 RSSWTWRRGRSRCWRRT*WRCRRR 906
>LOC_Os03g27610:12003.t02436:unspliced-genomic patatin T5 precursor, putative, expressed| Length = 1823 Score = 32.2 bits (64), Expect = 1.1 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -3 / +2 Query: 122 THRRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRR 6 T+ M G+ R WP RRS R W R+R SC R Sbjct: 1025 TNADRSMDGSIFARTYRRWWP*RRSPRR*W*RTRRSCTR 1141
>LOC_Os02g19924:12002.t01783:unspliced-genomic tyrosine aminotransferase, putative, expressed| Length = 19691 Score = 32.2 bits (64), Expect = 1.1 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 / +3 Query: 62 PWRRSKRAGWARSRASCRRR 3 PWRRS A RSRAS RRR Sbjct: 249 PWRRSDTATPPRSRASARRR 308
>LOC_Os06g17290:12006.t01601:unspliced-genomic phosphatidylinositol 3- and 4-kinase family protein, expressed| Length = 4238 Score = 32.2 bits (64), Expect = 1.1 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 / -3 Query: 73 RAAVTSSAPGMCVRLCVSES 132 R+ +S APG CVR CVSES Sbjct: 96 RSPPSSRAPGGCVRACVSES 37
>LOC_Os05g38280:12005.t03370:unspliced-genomic expressed protein| Length = 2018 Score = 26.7 bits (52), Expect(2) = 1.1 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 / -2 Query: 59 WRRSKRAGWARSR 21 WRR RAGW R R Sbjct: 235 WRRRGRAGWRRRR 197 Score = 24.4 bits (47), Expect(2) = 1.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 / -1 Query: 101 PGADDVTAARFTWP 60 PG DD+T AR +P Sbjct: 1868 PGGDDLTGARLPFP 1827
>LOC_Os08g09950:12008.t00880:unspliced-genomic acyl-desaturase, chloroplast precursor, putative, expressed| Length = 2326 Score = 25.8 bits (50), Expect(2) = 1.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 / +3 Query: 151 KCTTCSVSYHGQTMLNNF 204 KCTT S YH QT+ + F Sbjct: 2178 KCTTLSERYHLQTLTHFF 2231 Score = 25.4 bits (49), Expect(2) = 1.3 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +1 / +3 Query: 4 RRRQDARLLAHPARLDRLQGQVNRAAVTSSAPGMC 108 RRR R + R +G RA SAP C Sbjct: 708 RRRGSRRTCSRTRRCSAARGSTRRAPSCGSAPPAC 812
>LOC_Os07g33730:12007.t03051:unspliced-genomic NB-ARC domain containing protein, expressed| Length = 5913 Score = 24.4 bits (47), Expect(2) = 1.5 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -1 / -2 Query: 169 HCMWYIYSTHNERTQTHTDEHT 104 +C WYI + THT HT Sbjct: 4835 NCHWYIAG*FDCHWNTHTHTHT 4770 Score = 24.4 bits (47), Expect(2) = 1.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 / -2 Query: 123 HTQTNTHARSRRC 85 HT T+TH + RC Sbjct: 4787 HTHTHTHTHTERC 4749
>LOC_Os12g22090:12012.t01948:unspliced-genomic expressed protein| Length = 7387 Score = 31.8 bits (63), Expect = 1.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 / -3 Query: 98 GADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 G+ R+ W WRR GW R + +RR Sbjct: 2183 GSAQAAPRRWQWRWRRMWSPGWMRQKQQDKRR 2088
>LOC_Os10g32980:12010.t02606:unspliced-genomic CESA7 - cellulose synthase, expressed| Length = 4662 Score = 31.8 bits (63), Expect = 1.5 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 / +1 Query: 110 THMPGADDVTAARFTWPWRRSKRAGWARSRA 18 T P TA+R WP S A W RSR+ Sbjct: 1354 TGWPSGTSATASRAAWPRSISSSARWTRSRS 1446
>LOC_Os09g38600:12009.t03328:unspliced-genomic expressed protein| Length = 2090 Score = 31.8 bits (63), Expect = 1.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 / -2 Query: 62 PWRRSKRAGWARSRASCRRR 3 P RR++R GW +R CRRR Sbjct: 280 PCRRARRGGWWGTRRRCRRR 221
>LOC_Os09g23540:12009.t02038:unspliced-genomic mannitol dehydrogenase, putative, expressed| Length = 1980 Score = 31.8 bits (63), Expect = 1.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 / -2 Query: 59 WRRSKRAGWARSRASCR 9 WRR R GW R R+ CR Sbjct: 1043 WRRRSRPGWPRRRSPCR 993
>LOC_Os09g13530:12009.t01143:unspliced-genomic zinc finger C-x8-C-x5-C-x3-H type family protein, expressed| Length = 1052 Score = 31.8 bits (63), Expect = 1.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / -1 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR RA W R R +CR R Sbjct: 740 WRRRVRARWCRRRRTCRAR 684
>LOC_Os09g12350:12009.t01025:unspliced-genomic conserved hypothetical protein| Length = 8995 Score = 31.8 bits (63), Expect = 1.5 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 / -3 Query: 62 PWRRSKRAGWARSRASCRRR 3 PWR S+ A RSRA+C RR Sbjct: 8699 PWRASRSARGRRSRAACSRR 8640
>LOC_Os07g32710:12007.t02953:unspliced-genomic expressed protein| Length = 1402 Score = 31.8 bits (63), Expect = 1.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 / +3 Query: 74 RFTWPWRRSKRAGW 33 R+ WPWRR +R GW Sbjct: 381 RWWWPWRRWRRRGW 422
>LOC_Os07g07070:12007.t00586:unspliced-genomic anthranilate phosphoribosyltransferase-like protein, putative,| expressed Length = 3892 Score = 31.8 bits (63), Expect = 1.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 / -2 Query: 68 TWPWRRSKRAGWARSRASCRRR 3 T WR ++RAG AR+R CR R Sbjct: 1287 TTAWRAARRAGRARARRRCRSR 1222
>LOC_Os03g19420:12003.t01708:unspliced-genomic nicotianamine synthase 2, putative, expressed| Length = 1476 Score = 31.8 bits (63), Expect = 1.5 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -3 / +1 Query: 80 AARFTWPWRRSKRAGWARSRASCRRR 3 AARF W RR+ A W R A RRR Sbjct: 982 AARFQW*ARRASAARWRRPPARSRRR 1059
>LOC_Os02g51360:12002.t04720:unspliced-genomic hypothetical protein| Length = 444 Score = 31.8 bits (63), Expect = 1.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 / +1 Query: 80 AARFTWPWRRSKRAGWARSRASC 12 AAR+ W W+ +R GW A+C Sbjct: 280 AARWGWGWKGGRRDGWMDGDAAC 348
>LOC_Os01g54470:12001.t04864:unspliced-genomic anther-specific proline-rich protein APG, putative, expressed| Length = 2186 Score = 31.8 bits (63), Expect = 1.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 / -2 Query: 100 GMCVRLCVSESFHCVLNKCTTCSVS 174 G+CVR CVS + C + + C VS Sbjct: 745 GLCVRQCVSRVYSCAYVRTSCCPVS 671
>LOC_Os10g36610:12010.t02940:unspliced-genomic conserved hypothetical protein| Length = 270 Score = 31.3 bits (62), Expect = 2.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 / +2 Query: 65 WPWRRSKRAGWARSRASCRRR 3 W WRR R+G A S AS RRR Sbjct: 122 WRWRRRGRSGCACSSASWRRR 184
>LOC_Os09g36930:12009.t03169:unspliced-genomic aquaporin PIP2.7, putative, expressed| Length = 1420 Score = 31.3 bits (62), Expect = 2.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 / +3 Query: 62 PWRRSKRAGWARSRASCRRR 3 PWRR +R W R RA RRR Sbjct: 36 PWRRRRRWPWRRWRAERRRR 95
>LOC_Os09g28600:12009.t02538:unspliced-genomic expressed protein| Length = 1295 Score = 31.3 bits (62), Expect = 2.1 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 / +3 Query: 116 RRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 RR+ A A PWRR + W R CRRR Sbjct: 684 RRSSR*RASSRAARAVARPWRRRRSPPWTRRLPCCRRR 797
>LOC_Os07g45290:12007.t04168:unspliced-genomic cytochrome P450 72A1, putative, expressed| Length = 4274 Score = 31.3 bits (62), Expect = 2.1 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 / +2 Query: 80 AARFTWPWRRSKRAGWARSRASCRRR 3 AAR WPWRR +R R RRR Sbjct: 35 AARRPWPWRRRRRGWRCTRRRRGRRR 112
>LOC_Os07g37080:12007.t03377:unspliced-genomic F-box domain containing protein| Length = 1860 Score = 31.3 bits (62), Expect = 2.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 / +2 Query: 65 WPWRRSKRAGWARSRASCR 9 W WRR + W +S A+CR Sbjct: 2 WTWRRYRETCWRKSSAACR 58
>LOC_Os05g10650:12005.t00899:unspliced-genomic 6-phosphofructokinase 2, putative, expressed| Length = 2281 Score = 31.3 bits (62), Expect = 2.1 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -3 / -1 Query: 77 ARFTWPWRRSKRAGWARSRASCRRR 3 +R T PWR R G A S CRRR Sbjct: 1645 SRCTRPWRHGWRCGRAASSRRCRRR 1571
>LOC_Os03g61550:12003.t05385:unspliced-genomic dnaJ domain containing protein, expressed| Length = 1226 Score = 31.3 bits (62), Expect = 2.1 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = -3 / -3 Query: 122 THRRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 T RRT GA +R T RR +RAG + A RRR Sbjct: 1095 TPRRTAAAGAGGCAGSRGTAAGRRGRRAGTTAAAARHRRR 976
>LOC_Os03g18130:12003.t01587:unspliced-genomic asparagine synthetase, putative, expressed| Length = 4512 Score = 31.3 bits (62), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 / -3 Query: 65 WPWRRSKRAGWARSRASCRRR 3 W WR GW R R SC RR Sbjct: 3658 WRWRLRGWCGWRRRRRSCGRR 3596
>LOC_Os03g18120:12003.t01586:unspliced-genomic expressed protein| Length = 4706 Score = 31.3 bits (62), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 / +3 Query: 65 WPWRRSKRAGWARSRASCRRR 3 W WR GW R R SC RR Sbjct: 4509 WRWRLRGWCGWRRRRRSCGRR 4571
>LOC_Os03g06920:12003.t00558:unspliced-genomic DRD1, putative, expressed| Length = 7317 Score = 31.3 bits (62), Expect = 2.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 / +2 Query: 62 PWRRSKRAGWARSRASCRRR 3 PWRR +R W RSR+ RR Sbjct: 797 PWRRRRRNRWPRSRSCSSRR 856
>LOC_Os03g02390:12003.t00130:unspliced-genomic mitochondrial import inner membrane translocase subunit tim23,| putative, expressed Length = 1292 Score = 31.3 bits (62), Expect = 2.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 / -2 Query: 62 PWRRSKRAGWARSRASCRRR 3 PWRR +RA W+ +A +RR Sbjct: 85 PWRRRRRAAWSGRKAERKRR 26
>LOC_Os02g26400:12002.t02334:unspliced-genomic nuclease, EndA/NucM family protein, expressed| Length = 4778 Score = 31.3 bits (62), Expect = 2.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 / -2 Query: 101 PGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 P DD A W W AG + SCRRR Sbjct: 214 PPGDDAVLAGEGWAWAAGHGAGAGAAPGSCRRR 116
>LOC_Os02g09960:12002.t00843:unspliced-genomic protein kinase, putative, expressed| Length = 2372 Score = 31.3 bits (62), Expect = 2.1 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 / +3 Query: 122 THRRTHMPGADDVTAARFTWPWRRSKRAGWARS 24 T R+ G T + + WPWRR +R W S Sbjct: 1881 TCARSWTRGLAATTRSTWPWPWRRWRRGAWRGS 1979
>LOC_Os01g68420:12001.t06198:unspliced-genomic hypothetical protein| Length = 819 Score = 31.3 bits (62), Expect = 2.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 / +2 Query: 113 RTHMPGADDVTAARFTWPWRRSK 45 RT P + D AA +WPWRR + Sbjct: 290 RTKPPQSKDPAAAAASWPWRRRR 358
>LOC_Os01g53230:12001.t04745:unspliced-genomic conserved hypothetical protein| Length = 324 Score = 31.3 bits (62), Expect = 2.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 / +2 Query: 65 WPWRRSKRAGWARSRASCRRR 3 WPWRR+ A AR R RRR Sbjct: 47 WPWRRAPAAPTARRRRGRRRR 109
>LOC_Os09g08730:12009.t00667:unspliced-genomic nucleic acid binding NABP, putative| Length = 4689 Score = 24.0 bits (46), Expect(2) = 2.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 / +2 Query: 145 THNERTQTHTDEHT 104 TH + T THT HT Sbjct: 3431 THTQHTHTHT*AHT 3472 Score = 24.0 bits (46), Expect(2) = 2.7 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -3 / +3 Query: 59 WRRSKRAGW 33 WRR +R+GW Sbjct: 3603 WRRQRRSGW 3629
>LOC_Os07g41590:12007.t03814:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1459 Score = 25.8 bits (50), Expect(2) = 2.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 / -3 Query: 62 PWRRSKRAGWARSRASC 12 P RR +R G RSRA+C Sbjct: 1016 PRRRPRRGGRRRSRAAC 966 Score = 23.5 bits (45), Expect(2) = 2.8 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 / -1 Query: 122 THRRTHMPGADDVTAARFTWP 60 +H H+P A + FTWP Sbjct: 1393 SHDACHLPMAISLKINAFTWP 1331
>LOC_Os12g34200:12012.t03109:unspliced-genomic F-box domain containing protein| Length = 3606 Score = 30.9 bits (61), Expect = 2.9 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 / -2 Query: 116 RRTHMPGADDVTAARFTWPWR 54 +R+H P +D VT+A + W W+ Sbjct: 485 KRSHEPTSDGVTSASWRWSWK 423
>LOC_Os12g07874:12012.t004198:unspliced-genomic signal transducer, putative, expressed| Length = 3561 Score = 30.9 bits (61), Expect = 2.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 / -3 Query: 65 WPWRRSKRAGWARSRASCRR 6 W WRR +R W S CRR Sbjct: 1195 WRWRRRRRWSWMWSTCCCRR 1136
>LOC_Os09g20510:12009.t01785:unspliced-genomic major Facilitator Superfamily protein, expressed| Length = 2542 Score = 30.9 bits (61), Expect = 2.9 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 / +1 Query: 74 RFTWPWRRSKRAGWARSRASCRR 6 R +WP RR + AG RSR+S RR Sbjct: 1474 RGSWPGRRGRCAGSRRSRSSWRR 1542
>LOC_Os08g45110:12008.t04232:unspliced-genomic dehydration-responsive element-binding protein 2D, putative,| expressed Length = 1179 Score = 30.9 bits (61), Expect = 2.9 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -3 / -2 Query: 137 *KDSDTHRRTHMPGADDVTAARFTWPWRRSKRAGWARSR 21 *+ + HRR G +R PWRRS+R G R R Sbjct: 431 *QQQEEHRRWRRRGVG*GGRSRRRGPWRRSRRRGRRRGR 315
>LOC_Os08g10420:12008.t00926:unspliced-genomic anthranilate N-benzoyltransferase protein 1, putative, expressed| Length = 1824 Score = 30.9 bits (61), Expect = 2.9 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 / +2 Query: 56 RRSKRAGWARSRASCRRR 3 RR +RAG AR+ A+CRRR Sbjct: 1541 RRRRRAGGARTGAACRRR 1594
>LOC_Os05g05220:12005.t00412:unspliced-genomic glioma tumor suppressor candidate region gene 2 protein, putative,| expressed Length = 4636 Score = 30.9 bits (61), Expect = 2.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 / -3 Query: 62 PWRRSKRAGWARSRASCRRR 3 P RR +R W R R +CRRR Sbjct: 305 PRRRRRRRRWTRRRPACRRR 246
>LOC_Os04g38910:12004.t03461:unspliced-genomic atypical receptor-like kinase MARK, putative, expressed| Length = 2511 Score = 30.9 bits (61), Expect = 2.9 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -3 / +2 Query: 113 RTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 RT AR WR + R W R+R CRRR Sbjct: 1715 RTTASRTSSARRARRPAGWRGTARRRWWRTRGGCRRR 1825
>LOC_Os03g40650:12003.t03490:unspliced-genomic bromodomain associated family protein, expressed| Length = 8332 Score = 30.9 bits (61), Expect = 2.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 / +2 Query: 98 GADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 G + R WP R+ +R W RSR RRR Sbjct: 233 GEHEQQRRRGWWPGRQGRRRWWRRSRRRRRRR 328
>LOC_Os02g29510:12002.t02644:unspliced-genomic non-imprinted in Prader-Willi/Angelman syndrome region protein 1,| putative, expressed Length = 11896 Score = 30.9 bits (61), Expect = 2.9 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -3 / +3 Query: 119 HRRTHMPGADDVTAARFTWPWRRSKRAGW 33 HRR H P + W WRR +R W Sbjct: 3351 HRRQHEPPQPQGKWWTWRWKWRRERRRQW 3437
>LOC_Os02g12300:12002.t01028:unspliced-genomic pectate lyase precursor, putative, expressed| Length = 2832 Score = 30.9 bits (61), Expect = 2.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 / -2 Query: 68 TWPWRRSKRAGWARSRASCRRR 3 TW WRR R RA CRRR Sbjct: 1313 TWTWRRGPPTRRWRRRARCRRR 1248
>LOC_Os02g05640:12002.t00462:unspliced-genomic homeobox-leucine zipper protein ATHB-4, putative| Length = 1022 Score = 30.9 bits (61), Expect = 2.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 / -3 Query: 65 WPWRRSKRAGWARSRASCRR 6 WP RR +R W R +CRR Sbjct: 1014 WPCRRRRRRRWRRRGGACRR 955
>LOC_Os12g01420:12012.t00041:unspliced-genomic ammonium transporter 2, putative| Length = 1377 Score = 30.9 bits (61), Expect = 2.9 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 / +3 Query: 147 QHTMKGLRHTQTNTHARSRRCHGRTVHLALEA 52 +H ++G RH H R RC GR H A Sbjct: 984 RHVVQGRRHAGHPAHPRGVRCSGRRPHRRFRA 1079
>LOC_Os05g02020:12005.t00101:unspliced-genomic protein kinase APK1A, chloroplast precursor, putative, expressed| Length = 3345 Score = 30.9 bits (61), Expect = 2.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 / +3 Query: 121 HTDEHTCQEQTMSRPHGSLGLGG 53 H D H C+E RP GS G+ G Sbjct: 1674 HRDGHCCKEVESGRPPGSQGMAG 1742
>LOC_Os04g40850:12004.t03646:unspliced-genomic 26S proteasome non-ATPase regulatory subunit 6, putative, expressed| Length = 2850 Score = 30.9 bits (61), Expect = 2.9 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = -2 / -3 Query: 219 EHTNSKIIQHRLPMVGHTACGTFIQHTMKGLRHTQTNTHARSRRCHG 79 + S ++ ++P HT T HTQ+ HA S CHG Sbjct: 451 DQIKSNQLKRQIPTHTHTHTHTHTHTHTHTHTHTQSQKHAASGSCHG 311
>LOC_Os02g28170:12002.t02511:unspliced-genomic transferase, putative, expressed| Length = 1914 Score = 30.9 bits (61), Expect = 2.9 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 / -2 Query: 180 MVGHTACGTFIQHTMKGLRHTQTNTHARSRRCHG 79 ++ HT F HTM+ + Q + H S +C+G Sbjct: 1757 LINHTLIPLFTMHTMQTVPRWQLSEHTLSVQCYG 1656
>LOC_Os01g63190:12001.t05689:unspliced-genomic L-ascorbate oxidase precursor, putative, expressed| Length = 4849 Score = 30.9 bits (61), Expect = 2.9 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -2 / +1 Query: 216 HTNSKIIQHRLPMVGHTACGTFIQHTMKGLRHTQTNTHARSRRCH 82 H ++ HR GH G + H G+R ++ H R+RR H Sbjct: 3535 HARARAGAHRGRAHGHQRVGRQLLHGGAGVRQPVSDHHGRNRRHH 3669
>LOC_Os02g09980:12002.t00845:unspliced-genomic TMV response-related gene product, putative, expressed| Length = 917 Score = 24.4 bits (47), Expect(2) = 3.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 / +3 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR +R+G R + RRR Sbjct: 267 WRRGRRSGRGRFTSFSRRR 323 Score = 23.5 bits (45), Expect(2) = 3.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 / +3 Query: 122 THRRTHMPGADDVTAARFTWP 60 T RR PG+ TA +WP Sbjct: 102 TSRRRRRPGSSPPTAHSRSWP 164
>LOC_Os01g13740:12001.t01235:unspliced-genomic myb-like DNA-binding domain, SHAQKYF class family protein, expressed| Length = 7104 Score = 25.8 bits (50), Expect(2) = 3.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 / +2 Query: 50 SKRAGWARSRASCRRR 3 S RA W R R CRRR Sbjct: 4868 SGRATWRRRRRRCRRR 4915 Score = 25.4 bits (49), Expect(2) = 3.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 / +1 Query: 114 TNTHARSRRCHGR 76 ++ HA SR CHGR Sbjct: 3355 SSRHATSRHCHGR 3393
>LOC_Os12g31430:12012.t02847:unspliced-genomic helix-loop-helix DNA-binding domain containing protein| Length = 991 Score = 24.4 bits (47), Expect(2) = 3.6 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -3 / -3 Query: 83 TAARFTWPWRRSKR 42 +A + WPWRR +R Sbjct: 938 SAPGWRWPWRRRRR 897 Score = 24.0 bits (46), Expect(2) = 3.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 / -1 Query: 56 RRSKRAGWARSRASCRRR 3 RR RAG R+RA+ RRR Sbjct: 169 RRRGRAGRRRNRAARRRR 116
>LOC_Os04g27540:12004.t02457:unspliced-genomic terpene synthase 7, putative| Length = 7708 Score = 25.8 bits (50), Expect(2) = 3.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 / -2 Query: 193 ASFAHGRTHCMWYI 152 A H R HCMW++ Sbjct: 6333 ARITHKRAHCMWHM 6292 Score = 25.4 bits (49), Expect(2) = 3.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 / -2 Query: 123 HTQTNTHARSRRCHGRTVHLALEA 52 ++ + H RRC GR +HL L+A Sbjct: 5955 NSSRHKH*MCRRCLGR*IHLLLKA 5884
>LOC_Os03g30290:12003.t02641:unspliced-genomic expressed protein| Length = 2893 Score = 24.9 bits (48), Expect(2) = 3.8 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = -2 / -3 Query: 189 RLPMVGHTACGTFIQHTMKGLRHTQTNTHARSRRCH 82 R P+ G CG +G + A +RRCH Sbjct: 2438 RAPVDGADGCGGGPAGARRGADVAEAEGEAAARRCH 2331 Score = 24.9 bits (48), Expect(2) = 3.8 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 / -2 Query: 59 WRRSKRAGWARSRASCRRR 3 WR ++R GW R RRR Sbjct: 2001 WRAARRPGWRGWRRRRRRR 1945
>LOC_Os05g44030:12005.t03893:unspliced-genomic BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor, putative Length = 5748 Score = 25.8 bits (50), Expect(2) = 3.8 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 / -2 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR +R W R RRR Sbjct: 350 WRRRRRRSWPRRHRWSRRR 294 Score = 24.9 bits (48), Expect(2) = 3.8 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = -3 / -1 Query: 116 RRTHMPGADDVTAARFTWPWRR 51 RR H AAR W WRR Sbjct: 2190 RRRHQVAVRHRAAARRRWRWRR 2125
>LOC_Os01g12150:12001.t01083:unspliced-genomic hypothetical protein| Length = 2092 Score = 25.8 bits (50), Expect(2) = 3.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 / +1 Query: 80 AARFTWPWRRSKRAGWAR 27 AA F+W WRRS AR Sbjct: 1960 AAEFSWLWRRSSSRRRAR 2013 Score = 23.5 bits (45), Expect(2) = 3.9 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 / +2 Query: 120 TQTNTHARSRRCHGRTVHLAL 58 T +TH ++ CH HL L Sbjct: 182 TTVSTHQQTSPCHRAAAHLPL 244
>LOC_Os12g07190:12012.t00603:unspliced-genomic CBS domain containing protein, expressed| Length = 5068 Score = 30.4 bits (60), Expect = 3.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 / -2 Query: 83 TAARFTWPWRRSKRAGWARSRASCR 9 +A R W WRR R+ W R R R Sbjct: 294 SAGRGRWAWRRPSRSRWRRRRRGRR 220
>LOC_Os11g43830:12011.t03913:unspliced-genomic pectinesterase, putative, expressed| Length = 2543 Score = 30.4 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 / +3 Query: 56 RRSKRAGWARSRASCRRR 3 RRS R+GW R+R S RR Sbjct: 162 RRSSRSGWGRTRCSTARR 215
>LOC_Os09g10620:12009.t00853:unspliced-genomic seed maturation protein LEA 4, putative| Length = 558 Score = 30.4 bits (60), Expect = 3.9 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -3 / +2 Query: 77 ARFTWPWRRSKRAGWARSRASCRRR 3 AR W RR +R WAR R RRR Sbjct: 17 ARARWRRRRRRRRTWARRRGRGRRR 91
>LOC_Os08g05660:12008.t00460:unspliced-genomic expressed protein| Length = 4193 Score = 30.4 bits (60), Expect = 3.9 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 / +2 Query: 80 AARFTWPWRRSKRAGWARSRASCRRR 3 AAR+ RR +R GW R SCR R Sbjct: 32 AARWGRRRRRRRRRGWRSRRGSCRTR 109
>LOC_Os08g04650:12008.t00359:unspliced-genomic pectinesterase inhibitor domain containing protein, expressed| Length = 1100 Score = 30.4 bits (60), Expect = 3.9 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / +1 Query: 83 TAARFTWPWRRSKRAGWAR 27 TA R PWRR+ R WAR Sbjct: 127 TACRGCRPWRRASRRAWAR 183
>LOC_Os07g43220:12007.t03969:unspliced-genomic SKP1-like protein 1A, putative| Length = 666 Score = 30.4 bits (60), Expect = 3.9 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / +2 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR +R W R R SC RR Sbjct: 131 WRRRERPRWRRRRISC*RR 187
>LOC_Os07g34910:12007.t03166:unspliced-genomic aspartic proteinase nepenthesin-1 precursor, putative| Length = 540 Score = 30.4 bits (60), Expect = 3.9 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 / -3 Query: 62 PWRRSKRAGWARSRASCRRR 3 P RRS + WAR R SC RR Sbjct: 337 PCRRSASSSWAR*RRSCSRR 278
>LOC_Os06g11330:12006.t01010:unspliced-genomic MADS-box transcription factor 22, putative, expressed| Length = 10711 Score = 30.4 bits (60), Expect = 3.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 / -2 Query: 68 TWPWRRSKRAGWARSRASCRRR 3 TW WR + W R R + RRR Sbjct: 309 TWSWRTGRACRWRRRRRARRRR 244
>LOC_Os05g05730:12005.t00463:unspliced-genomic OsGrx_S1 - glutaredoxin subgroup III| Length = 345 Score = 30.4 bits (60), Expect = 3.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 / -3 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR +RA R+R+ CRRR Sbjct: 199 WRRCRRATSRRARSPCRRR 143
>LOC_Os04g55210:12004.t04994:unspliced-genomic chloride channel-like protein CLC-g, putative, expressed| Length = 4785 Score = 30.4 bits (60), Expect = 3.9 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 / -1 Query: 74 RFTWPWRRSKRAGWARSRASCRRR 3 R TW RRS+R GW R R R R Sbjct: 567 RRTWRRRRSRRRGWRRIRRRRRGR 496
>LOC_Os04g51380:12004.t04615:unspliced-genomic protein-S-isoprenylcysteine O-methyltransferase., putative,| expressed Length = 3556 Score = 30.4 bits (60), Expect = 3.9 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 / +3 Query: 65 WPWRRSKRAGWARSRAS 15 WPWRR +R G +R R S Sbjct: 216 WPWRRGRRRGCSRPRWS 266
>LOC_Os04g08080:12004.t00681:unspliced-genomic expressed protein| Length = 2398 Score = 30.4 bits (60), Expect = 3.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -3 / -1 Query: 83 TAARFTWPWRRSKRAGWARSRASCRR 6 +++R TWP RR A SR SCRR Sbjct: 508 SSSRRTWPRRRRASARTPGSRPSCRR 431
>LOC_Os03g07640:12003.t00625:unspliced-genomic sulfated surface glycoprotein 185 precursor, putative| Length = 630 Score = 30.4 bits (60), Expect = 3.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 / -1 Query: 74 RFTWPWRRSKRAGWARSRASCRRR 3 R W WRR +RAG R +C RR Sbjct: 234 RRRWRWRRHQRAGRRRWWRACNRR 163
>LOC_Os02g53770:12002.t04956:unspliced-genomic isoleucyl-tRNA synthetase, putative, expressed| Length = 11013 Score = 30.4 bits (60), Expect = 3.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 / -2 Query: 83 TAARFTWPWRRSKRAGWARSRASCR 9 T R PW R++R GW+R + R Sbjct: 10709 TGGRSMTPWHRAQRVGWSRKDPTSR 10635
>LOC_Os02g33710:12002.t03012:unspliced-genomic histidine decarboxylase, putative, expressed| Length = 3115 Score = 30.4 bits (60), Expect = 3.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 / +2 Query: 74 RFTWPWRRSKRAGWARSRASCRRR 3 R+ W WR S+R G R R RRR Sbjct: 89 RWRWRWRWSRRRGLRRRRGRGRRR 160
>LOC_Os02g01740:12002.t00074:unspliced-genomic U5 small nuclear ribonucleoprotein 200 kDa helicase, putative,| expressed Length = 7863 Score = 30.4 bits (60), Expect = 3.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 / -3 Query: 77 ARFTWPWRRSKRAGWARS 24 AR WP RR +R+ W RS Sbjct: 199 ARGAWPGRRGRRSSWGRS 146
>LOC_Os01g73620:12001.t06641:unspliced-genomic expressed protein| Length = 7983 Score = 30.4 bits (60), Expect = 3.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 / +1 Query: 62 PWRRSKRAGWAR 27 PWRRS R+GW R Sbjct: 430 PWRRSSRSGWCR 465
>LOC_Os01g47280:12001.t04176:unspliced-genomic expressed protein| Length = 3713 Score = 30.4 bits (60), Expect = 3.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 / +1 Query: 68 TWPWRRSKRAGWARSRASCRRR 3 TW RR++RAG RSR+ RR Sbjct: 3424 TWTPRRTRRAGGTRSRSPAARR 3489
>LOC_Os01g43350:12001.t03851:unspliced-genomic ATP binding protein, putative, expressed| Length = 3808 Score = 30.4 bits (60), Expect = 3.9 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 / -3 Query: 122 THRRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 T RR G A R+ WRR++R+G R A RRR Sbjct: 1151 TPRRRGRRGGARGAAPRWRATWRRARRSGAGREPAP*RRR 1032
>LOC_Os01g37690:12001.t03309:unspliced-genomic vacuolar cation/proton exchanger 1a, putative, expressed| Length = 5361 Score = 30.4 bits (60), Expect = 3.9 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / +2 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR R G A R +CRRR Sbjct: 239 WRRGTRTGGAGRRTTCRRR 295
>LOC_Os01g19170:12001.t01707:unspliced-genomic polygalacturonase precursor, putative, expressed| Length = 1796 Score = 30.4 bits (60), Expect = 3.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 / -2 Query: 65 WPWRRSKRAGWARSRASCRR 6 W WRR +R R+R CRR Sbjct: 1639 WAWRRCRRRSSRRARRRCRR 1580
>LOC_Os01g06740:12001.t00557:unspliced-genomic protein synthesis inhibitor I, putative, expressed| Length = 1574 Score = 30.4 bits (60), Expect = 3.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 / +3 Query: 74 RFTWPWRRSKRAGWARSRASCR 9 R +WPWRR +R G S CR Sbjct: 813 RRSWPWRRPRRWGSCCSSRRCR 878
>LOC_Os01g03670:12001.t00258:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 1332 Score = 30.4 bits (60), Expect = 3.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 / +1 Query: 59 WRRSKRAGWARSRAS 15 WRR +R GW RS AS Sbjct: 664 WRRGRRGGWPRSAAS 708
>LOC_Os11g18900:12011.t01660:unspliced-genomic expressed protein| Length = 2529 Score = 30.4 bits (60), Expect = 4.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 / -2 Query: 136 HCVLNKCTTCSVSYHGQTMLN 198 HC KC CS+ + G T++N Sbjct: 1760 HCRGRKCQICSLDFEGSTLMN 1698
>LOC_Os10g38780:12010.t03118:unspliced-genomic glutathione S-transferase GSTU6, putative, expressed| Length = 1222 Score = 30.4 bits (60), Expect = 4.0 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +2 / +1 Query: 2 DDADKMLDFLPTLLAWIASK 61 DDADKML+F T LA ASK Sbjct: 877 DDADKMLEFRQTALALGASK 936
>LOC_Os10g37690:12010.t03029:unspliced-genomic inner membrane protein OXA1, mitochondrial precursor, putative,| expressed Length = 4941 Score = 30.4 bits (60), Expect = 4.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 / -1 Query: 178 GRTHCMWYIYSTHNERTQTHTDEH 107 G+THC W ++H+ R H H Sbjct: 3363 GKTHCEWDCQNSHSSRKVLHFSSH 3292
>LOC_Os04g52200:12004.t04696:unspliced-genomic multiple RNA-binding domain-containing protein 1, putative, expressed| Length = 6619 Score = 30.4 bits (60), Expect = 4.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 / -2 Query: 127 QTHTDEHTCQEQTMSRPHGS 68 QT T EH CQ T + PHGS Sbjct: 4827 QT*TVEHKCQNPTWTWPHGS 4768
>LOC_Os03g63270:12003.t05544:unspliced-genomic regulatory protein, putative, expressed| Length = 4764 Score = 30.4 bits (60), Expect = 4.0 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 / +3 Query: 7 RRQDARLLAHPARLDRLQGQVNRAAVTSSAP 99 RRQDAR P RL+ L G R A P Sbjct: 4236 RRQDARPPRRPRRLEELHGGAARRAALGQVP 4328
>LOC_Os03g46400:12003.t04007:unspliced-genomic flavonol-3-O-glycoside-7-O-glucosyltransferase 1, putative,| expressed Length = 2278 Score = 30.4 bits (60), Expect = 4.0 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 / -3 Query: 121 HTDEHTCQEQTMSRPHGSLGLGGDPSEQGG 32 HTD H C+ G G GG PS G Sbjct: 302 HTDRHGCRGHCCEVARGDDGCGGSPSAVAG 213
>LOC_Os03g46390:12003.t04006:unspliced-genomic ras-related protein RHN1, putative, expressed| Length = 6551 Score = 30.4 bits (60), Expect = 4.0 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 / +1 Query: 121 HTDEHTCQEQTMSRPHGSLGLGGDPSEQGG 32 HTD H C+ G G GG PS G Sbjct: 4933 HTDRHGCRGHCCEVARGDDGCGGSPSAVAG 5022
>LOC_Os02g12380:12002.t01036:unspliced-genomic histone deacetylase, putative, expressed| Length = 6090 Score = 30.4 bits (60), Expect = 4.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 / -2 Query: 154 IYSTHNERTQTHTDEHTCQEQTMSRPHGSLGLGG 53 IYS H + T++H + M+ PHG+ G G Sbjct: 770 IYSKH*TNPKKKTNKHKYERNRMTSPHGA*GARG 669
>LOC_Os01g61330:12001.t05512:unspliced-genomic ankyrin-2, putative, expressed| Length = 2148 Score = 30.4 bits (60), Expect = 4.0 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 / +1 Query: 73 RAAVTSSAPGMCVRLCVSESFHCVLNKCTTCSV 171 R A ++AP +C+ S S C +C CS+ Sbjct: 1852 RGADEAAAPALCIASSSSSSISCA*IRCVHCSI 1950
>LOC_Os01g57890:12001.t05190:unspliced-genomic ATML1, putative, expressed| Length = 6636 Score = 30.4 bits (60), Expect = 4.0 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 / -2 Query: 123 HTQTNTHARSRRCHGRTVHLALEAIQAS 40 HT T+TH +R G VH LE S Sbjct: 5144 HTHTHTHTTKQRKDGNVVHAKLETAPCS 5061
>LOC_Os05g27870:12005.t02438:unspliced-genomic expressed protein| Length = 12086 Score = 28.1 bits (55), Expect(2) = 4.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 / +2 Query: 106 CVRLCVSESFHCVLNKCTTCSVSY 177 C +C+S S H L +CT S++Y Sbjct: 3824 CSNICISGSTHKHLLRCTLPSINY 3895 Score = 23.5 bits (45), Expect(2) = 4.1 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +1 / +2 Query: 76 AAVTSSAPGMCV 111 AAVT +APG+C+ Sbjct: 407 AAVTVAAPGLCL 442
>LOC_Os09g18360:12009.t01621:unspliced-genomic senescence-induced receptor-like serine/threonine-protein kinase| precursor, putative, expressed Length = 9388 Score = 29.0 bits (57), Expect(2) = 4.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 / -3 Query: 74 RFTWPWRRSKRAGWARSRASCRRR 3 R+ W WRRS + R R + RRR Sbjct: 392 RWPWQWRRSGDSPLRRRRCTARRR 321 Score = 22.1 bits (42), Expect(2) = 4.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 / -2 Query: 132 GLRHTQTNTHARS 94 GL HT T+TH + Sbjct: 4005 GLTHTHTHTHTHT 3967
>LOC_Os04g44670:12004.t04007:unspliced-genomic AP2 domain containing protein, expressed| Length = 1935 Score = 24.0 bits (46), Expect(2) = 5.2 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 / +3 Query: 62 PWRRSKRAGWARSRASCRRR 3 P R + RAG R C RR Sbjct: 1074 PGRNASRAGGVRRHVGCSRR 1133 Score = 23.1 bits (44), Expect(2) = 5.2 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 / +3 Query: 126 RHTQTNTHARSRRCHGRTVH 67 +H T++ A HGR+VH Sbjct: 936 KHAATSSSAARTAGHGRSVH 995
>LOC_Os02g57260:12002.t05298:unspliced-genomic 3-ketoacyl-CoA thiolase 2, peroxisomal precursor, putative,| expressed Length = 4323 Score = 25.8 bits (50), Expect(2) = 5.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 / -3 Query: 62 PWRRSKRAGWARS 24 PW RS+RA W+ S Sbjct: 136 PWLRSERASWSSS 98 Score = 24.0 bits (46), Expect(2) = 5.4 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -1 / -2 Query: 175 RTHCMWYIYSTHN 137 R HC WY Y N Sbjct: 3086 RLHCSWYCYCRTN 3048
>LOC_Os11g17160:12011.t01494:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4207 Score = 29.9 bits (59), Expect = 5.4 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 / +3 Query: 122 THRRTHMPGADDVTAARFTWPWRRS 48 THRRT P RF+W WRR+ Sbjct: 3741 THRRT*SPIESVRALMRFSWYWRRA 3815
>LOC_Os08g41410:12008.t03870:unspliced-genomic glucan endo-1,3-beta-glucosidase A6 precursor, putative| Length = 2810 Score = 29.9 bits (59), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 / -1 Query: 68 TWPWRRSKRAGWARSRASCRR 6 T PWR RA AR R CRR Sbjct: 698 TSPWRSGTRAAAARRRRRCRR 636
>LOC_Os08g31870:12008.t02932:unspliced-genomic cell division cycle protein 48, putative, expressed| Length = 4002 Score = 29.9 bits (59), Expect = 5.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 / -2 Query: 62 PWRRSKRAGWARSRASCR 9 P RR++RAGW RSR + R Sbjct: 2093 PPRRTRRAGWPRSRRASR 2040
>LOC_Os08g02180:12008.t04271:unspliced-genomic expressed protein| Length = 1026 Score = 29.9 bits (59), Expect = 5.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 / +3 Query: 68 TWPWRRSKRAGWARSRASCRR 6 TW WRR +GW R R C R Sbjct: 606 TWGWRRRCCSGW*RRRCWCCR 668
>LOC_Os06g44050:12006.t04093:unspliced-genomic methyladenine glycosylase family protein, expressed| Length = 3029 Score = 29.9 bits (59), Expect = 5.4 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 / +2 Query: 56 RRSKRAGWARSRASCRRR 3 RR A WAR+R CRRR Sbjct: 578 RRMPAAAWARARPPCRRR 631
>LOC_Os06g36590:12006.t03355:unspliced-genomic inner membrane protein ybaL, putative, expressed| Length = 8117 Score = 29.9 bits (59), Expect = 5.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 / +3 Query: 65 WPWRRSKRAGWARSRASCR 9 W W R +R GWAR R R Sbjct: 210 WGWWRRRRCGWARRRRRWR 266
>LOC_Os06g29994:12006.t02702:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 12341 Score = 29.9 bits (59), Expect = 5.4 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 / -2 Query: 116 RRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRR 6 R H+PG R +WPWRR + R + RR Sbjct: 274 RVLHVPGG*SR*RRRRSWPWRRRRGGARRGGRRTSRR 164
>LOC_Os06g15550:12006.t01428:unspliced-genomic expressed protein| Length = 1182 Score = 29.9 bits (59), Expect = 5.4 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 / -2 Query: 62 PWRRSKRAGWARSRASCRRR 3 PW+RSK+ G+ RS+ + R R Sbjct: 221 PWKRSKQEGYLRSQLAARPR 162
>LOC_Os06g10850:12006.t00962:unspliced-genomic triacylglycerol lipase, putative, expressed| Length = 3416 Score = 29.9 bits (59), Expect = 5.4 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = -3 / +1 Query: 158 VHLFNTQ*KDSDTHRRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 ++L * S HRR P AD AA T + + WA + C RR Sbjct: 1 INLLVRS*ARSRAHRRRRRPPADQSPAAWTTTTTAGGEMSPWATNSWCCSRR 156
>LOC_Os05g45440:12005.t04032:unspliced-genomic expressed protein| Length = 698 Score = 29.9 bits (59), Expect = 5.4 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 / +1 Query: 56 RRSKRAGWARSRASCRRR 3 RR +R W R RA CRRR Sbjct: 379 RRRRRRRWRRRRARCRRR 432
>LOC_Os05g02400:12005.t00139:unspliced-genomic RNA binding protein, putative, expressed| Length = 2853 Score = 29.9 bits (59), Expect = 5.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / +2 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR +RA W R R RRR Sbjct: 278 WRRRRRAKWVRRRRRRRRR 334
>LOC_Os03g47830:12003.t04145:unspliced-genomic argonaute-like protein, putative, expressed| Length = 12542 Score = 29.9 bits (59), Expect = 5.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / +2 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR R GW R+R RRR Sbjct: 233 WRRRWRPGWRRARGRRRRR 289
>LOC_Os03g27980:12003.t02471:unspliced-genomic glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed| Length = 1776 Score = 29.9 bits (59), Expect = 5.4 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 / -3 Query: 107 HMPGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 H PG TAA RRS+R W R A+ R R Sbjct: 724 HRPGRWPATAATPATGSRRSRRGSWGRPGATGRGR 620
>LOC_Os03g20800:12003.t01836:unspliced-genomic hypothetical protein| Length = 877 Score = 29.9 bits (59), Expect = 5.4 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 / -2 Query: 74 RFTWPWRRSKRAGWARSRASCRR 6 R W WR+ R W R R C R Sbjct: 159 RRPWQWRQGGRQQWQRMRTRCSR 91
>LOC_Os03g08250:12003.t00683:unspliced-genomic expressed protein| Length = 927 Score = 29.9 bits (59), Expect = 5.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 / +2 Query: 116 RRTHMPGADDVTAARFTWPWRRSKR 42 R + +PGA T R+ W WRR R Sbjct: 395 RSSPLPGAAPGTTGRWWWRWRRRSR 469
>LOC_Os02g54640:12002.t05043:unspliced-genomic glutamate receptor 2.9 precursor, putative, expressed| Length = 6890 Score = 29.9 bits (59), Expect = 5.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 / +1 Query: 65 WPWRRSKRAGWARSRASCRRR 3 W RS+RAGW R + CR R Sbjct: 4927 WGM*RSRRAGWRRWTSRCRSR 4989
>LOC_Os02g34250:12002.t03064:unspliced-genomic expressed protein| Length = 975 Score = 29.9 bits (59), Expect = 5.4 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = -3 / +2 Query: 89 DVTAARFTWPWRRSKRAGWARSRASCRRR 3 DV AR RRS RA R+ ASCRRR Sbjct: 62 DVEVARRWAAVRRSARAVVGRAAASCRRR 148
>LOC_Os02g31300:12002.t02822:unspliced-genomic UBX domain containing protein| Length = 702 Score = 29.9 bits (59), Expect = 5.4 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -3 / +2 Query: 95 ADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 +D TA RF P R+GW S A RRR Sbjct: 509 SDTATATRFRRPAAGGGRSGWCGSPARRRRR 601
>LOC_Os12g44040:12012.t04070:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 3257 Score = 29.9 bits (59), Expect = 5.5 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 / -1 Query: 43 RLDRLQGQVNRAAVTSSAPGMCVRLCVSESFHC 141 R LQ + + +SS PG LC SFHC Sbjct: 554 RPPHLQQATSSGSASSSTPGPKPTLCTLASFHC 456
>LOC_Os11g37020:12011.t03246:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1406 Score = 29.9 bits (59), Expect = 5.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 / -1 Query: 145 THNERTQTHTDEHTCQEQTMSRPHGSLGLGG 53 T + RT+ T H C +SR + + GLGG Sbjct: 944 TPSRRTRCRTSVHICDRARISRHNCNTGLGG 852
>LOC_Os10g42550:12010.t03480:unspliced-genomic inositol-tetrakisphosphate 1-kinase 1, putative, expressed| Length = 1718 Score = 29.9 bits (59), Expect = 5.5 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +1 / -1 Query: 64 QVNRAAVTSSAPGMCVRLCVSESFHCVLNKCTTCSVSYHG 183 +++ A +TSS+ G+ +RL VS S + K + +VSY G Sbjct: 1172 EIDVAHLTSSSLGLGLRLGVSSSL*TISQKKSVSTVSYPG 1053
>LOC_Os09g34930:12009.t03020:unspliced-genomic acyltransferase, putative, expressed| Length = 1635 Score = 29.9 bits (59), Expect = 5.5 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +1 / -1 Query: 4 RRRQDARLLAHPARLDRLQGQVNRAAVTSS 93 +RR++ L+AH ARLD L +++ A V ++ Sbjct: 387 QRRREVGLVAHAARLDHLGHELHAAVVEAA 298
>LOC_Os09g04240:12009.t00320:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7822 Score = 29.9 bits (59), Expect = 5.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 / -2 Query: 157 TTCSVSYHGQTMLNNFAVCV 216 TTCS HG TMLN C+ Sbjct: 7656 TTCSFLLHGSTMLNT*TTCL 7597
>LOC_Os06g45830:12006.t04271:unspliced-genomic expressed protein| Length = 5274 Score = 29.9 bits (59), Expect = 5.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -1 / +2 Query: 136 ERTQTHTDEHTCQEQTMSRPHGSLGLGGDPSEQGG 32 +RTQ+H + T SR G G GG S +GG Sbjct: 89 QRTQSHPSSSPSPKSTASRGGGGGGGGGAASGRGG 193
>LOC_Os03g47580:12003.t04118:unspliced-genomic ubiquitin conjugating enzyme, putative, expressed| Length = 8471 Score = 29.9 bits (59), Expect = 5.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 / +3 Query: 130 SFHCVLNKCTTCSVSYH 180 SFHC L+KC C + H Sbjct: 7836 SFHCFLHKCLACVILVH 7886
>LOC_Os03g04410:12003.t00320:unspliced-genomic aconitate hydratase, cytoplasmic, putative, expressed| Length = 6895 Score = 29.9 bits (59), Expect = 5.5 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -1 / -2 Query: 187 FAHGRTHCMWYIYSTHNERTQTHTDEHTC 101 F H HC + +Y+T++ + T T H+C Sbjct: 2529 FFHLAKHCSFCLYTTNSPSSNTKTIYHSC 2443
>LOC_Os02g31140:12002.t02807:unspliced-genomic major ampullate spidroin 2-2, putative, expressed| Length = 2753 Score = 29.9 bits (59), Expect = 5.5 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +1 / -3 Query: 1 GRRRQDARLLAHPARLDRLQGQVNRAAVTSSAPGMCVRLC 120 GRR + R R R G+ RA T +PG C R C Sbjct: 2268 GRRCRRRRSRCRRRRPTRRWGRTTRAWTTRRSPGCCWRCC 2149
>LOC_Os01g12950:12001.t01161:unspliced-genomic ubiquitin-conjugating enzyme, putative, expressed| Length = 17122 Score = 29.9 bits (59), Expect = 5.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 / +3 Query: 130 SFHCVLNKCTTCSVSYH 180 SFHC L+KC C + H Sbjct: 8298 SFHCFLHKCLACVILVH 8348
>LOC_Os10g25040:12010.t01927:unspliced-genomic red chlorophyll catabolite reductase, putative, expressed| Length = 2333 Score = 24.4 bits (47), Expect(2) = 5.7 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 / -3 Query: 65 WPWRRSKR 42 WPWRR++R Sbjct: 2118 WPWRRARR 2095 Score = 24.4 bits (47), Expect(2) = 5.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / -3 Query: 53 RSKRAGWARSRASCRR 6 R +R W RS CRR Sbjct: 1941 RGRRGPWRRSTGGCRR 1894
>LOC_Os02g36440:12002.t03281:unspliced-genomic sugar transport protein 5, putative, expressed| Length = 4628 Score = 25.4 bits (49), Expect(2) = 5.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 / +3 Query: 65 WPWRRSKRAGWA 30 WPWR S WA Sbjct: 3936 WPWRGSSARSWA 3971 Score = 24.4 bits (47), Expect(2) = 5.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -2 / +1 Query: 192 HRLPMVGHTACGTFIQHTMKGLRHT 118 H P V T C TFI + RHT Sbjct: 2428 HFSPEVTKTICSTFIPTSRSLTRHT 2502
>LOC_Os02g18180:12002.t01611:unspliced-genomic ATP-binding cassette sub-family E member 1, putative, expressed| Length = 6460 Score = 25.4 bits (49), Expect(2) = 5.8 Identities = 6/20 (30%), Positives = 15/20 (75%) Frame = +1 / +2 Query: 142 VLNKCTTCSVSYHGQTMLNN 201 +++KC CS+ + G+ ++N+ Sbjct: 4397 IISKCLCCSIYFCGRKLINH 4456 Score = 24.9 bits (48), Expect(2) = 5.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 / +2 Query: 73 RAAVTSSAPGMCVRLCVSESFHCVLNKC 156 RAA++SS+ G R+ V C +KC Sbjct: 242 RAAMSSSSSGRSSRIAVVTEDRCRPSKC 325
>LOC_Os11g42910:12011.t03821:unspliced-genomic conserved hypothetical protein| Length = 7358 Score = 27.6 bits (54), Expect(2) = 6.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 / -3 Query: 74 RFTWPWRRSKRAGWARSRASCRRR 3 R TW RS RA W R S RRR Sbjct: 411 RATWCALRSHRASWRALRHSRRRR 340 Score = 22.6 bits (43), Expect(2) = 6.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 / -1 Query: 182 PW*DTLHVVHLFNTQ*KDSDTHRRT 108 P+ DTL + H+ N KDS + R T Sbjct: 4964 PFQDTLSLYHIMN*FCKDSPSVRYT 4890
>LOC_Os01g40190:12001.t03545:unspliced-genomic expressed protein| Length = 2687 Score = 27.2 bits (53), Expect(2) = 6.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -3 / +3 Query: 83 TAARFTWPWRRSKRAGWARSRAS 15 T R WPW R + + W+ + +S Sbjct: 2490 TTHRRPWPWPRRRESSWSSAPSS 2558 Score = 21.7 bits (41), Expect(2) = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 / +3 Query: 135 KGLRHTQTNTHARSRRCHGRTVH 67 +GLR ++ ARS R +T H Sbjct: 2430 RGLRWRRSTRTARSGRGRSKTTH 2498
>LOC_Os06g35650:12006.t03262:unspliced-genomic reticuline oxidase precursor, putative, expressed| Length = 1815 Score = 23.5 bits (45), Expect(2) = 7.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 / -1 Query: 68 TWPWRRSKRAGWARSRASCRRR 3 +WP R + RSR+S RRR Sbjct: 1539 SWPRRSTSPPTPCRSRSSSRRR 1474 Score = 23.1 bits (44), Expect(2) = 7.0 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 / -2 Query: 125 DTHRRTHMPGADDVTAA 75 DTH RTHM T+A Sbjct: 1703 DTHARTHMHQLSQETSA 1653
>LOC_Os11g12490:12011.t01136:unspliced-genomic transposon protein, putative, unclassified| Length = 6136 Score = 27.6 bits (54), Expect(2) = 7.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 / -1 Query: 83 TAARFTWPWRRSKRAGWARSRASCR 9 T AR +WP R ++R R+ CR Sbjct: 388 TTARASWPCRATRRTRTTRTARPCR 314 Score = 22.1 bits (42), Expect(2) = 7.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 / -3 Query: 184 AHGRTHCMWYIYSTHNE 134 AH R+H WY ++ + E Sbjct: 5318 AHLRSHHTWYSFARYAE 5268
>LOC_Os02g45620:12002.t04149:unspliced-genomic plant-specific domain TIGR01568 family protein, expressed| Length = 1030 Score = 24.4 bits (47), Expect(2) = 7.4 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 / +1 Query: 117 QTNTHARSRRCHGRTVHL 64 Q R RRCHG+T L Sbjct: 493 QEGEERRQRRCHGQTRRL 546 Score = 22.1 bits (42), Expect(2) = 7.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = -3 / +3 Query: 65 WPWRRSKRAGWARSRASCRR 6 W W S WA S + C R Sbjct: 600 WRW*SSPTTRWATSGSRCCR 659
>LOC_Os12g35710:12012.t03259:unspliced-genomic extensin-like protein, putative, expressed| Length = 2620 Score = 29.5 bits (58), Expect = 7.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 / +2 Query: 68 TWPWRRSKRAGWARSRASCRR 6 TWP + +G SRASCRR Sbjct: 578 TWPCSSTSTSGSTTSRASCRR 640
>LOC_Os12g12664:12012.t01134:unspliced-genomic expressed protein| Length = 5192 Score = 29.5 bits (58), Expect = 7.4 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 / -1 Query: 65 WPWRRSKRAGWARSRASCRR 6 W WRR + A W +CRR Sbjct: 3353 WTWRRGEPATWRGRAGTCRR 3294
>LOC_Os11g10890:12011.t00977:unspliced-genomic expressed protein| Length = 602 Score = 29.5 bits (58), Expect = 7.4 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 / -2 Query: 119 HRRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCR 9 HR TH+ G D TA + RR + +G A CR Sbjct: 247 HRSTHLCGGDRATAPWWCCRRRRQRASGRAADLRWCR 137
>LOC_Os11g08340:12011.t00725:unspliced-genomic indole-3-acetic acid-amido synthetase GH3.12, putative| Length = 2031 Score = 29.5 bits (58), Expect = 7.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 / -3 Query: 59 WRRSKRAGWARSRASCRR 6 WRR +R R+R SCRR Sbjct: 1615 WRRCRRRAGGRARCSCRR 1562
>LOC_Os11g05080:12011.t00401:unspliced-genomic expressed protein| Length = 4305 Score = 29.5 bits (58), Expect = 7.4 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 / +2 Query: 77 ARFTWPWRRSKRAGW 33 +R+ W WRR +R+GW Sbjct: 185 SRWRWWWRRRRRSGW 229
>LOC_Os10g35810:12010.t02871:unspliced-genomic uncharacterized low-complexity proteins, putative, expressed| Length = 3298 Score = 29.5 bits (58), Expect = 7.4 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 / +1 Query: 86 VTAARFTWPWRRSKRAGWARSRASCRRR 3 + A TWP RR AG S SCRRR Sbjct: 3004 LAAPSSTWPARRRAPAGERCSIMSCRRR 3087
>LOC_Os10g35800:12010.t02870:unspliced-genomic expressed protein| Length = 2064 Score = 29.5 bits (58), Expect = 7.4 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 / -2 Query: 86 VTAARFTWPWRRSKRAGWARSRASCRRR 3 + A TWP RR AG S SCRRR Sbjct: 1388 LAAPSSTWPARRRAPAGERCSIMSCRRR 1305
>LOC_Os10g33210:12010.t02623:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 5356 Score = 29.5 bits (58), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 / -2 Query: 65 WPWRRSKRAGWARSRASCRR 6 W WRR R ARSR S RR Sbjct: 3969 WRWRRRGRGWGARSRRSSRR 3910
>LOC_Os09g28310:12009.t02509:unspliced-genomic bZIP transcription factor, putative, expressed| Length = 4038 Score = 29.5 bits (58), Expect = 7.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 / +3 Query: 71 FTWPWRRSKRAGWARSRASCRRR 3 + WPW R +R AR+R+ C R Sbjct: 492 WAWPWGRRRRRCSARARSPCPAR 560
>LOC_Os09g27170:12009.t02396:unspliced-genomic conserved hypothetical protein| Length = 354 Score = 29.5 bits (58), Expect = 7.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 / +3 Query: 59 WRRSKRAGWARSRASCRRR 3 WR S + W S SCRRR Sbjct: 54 WRTSSGSSWRTSSGSCRRR 110
>LOC_Os09g25540:12009.t02233:unspliced-genomic receptor-like protein kinase precursor, putative, expressed| Length = 3592 Score = 29.5 bits (58), Expect = 7.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 / -1 Query: 74 RFTWPWRRSKRAGWARSRASCR 9 R W WRR +R W R R S R Sbjct: 2797 RACWRWRRRRRRRWRRRRRS*R 2732
>LOC_Os08g44770:12008.t04200:unspliced-genomic superoxide dismutase, chloroplast precursor, putative, expressed| Length = 3226 Score = 29.5 bits (58), Expect = 7.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / -2 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR +RA W R R RRR Sbjct: 387 WRRRRRAPWQRRRPRGRRR 331
>LOC_Os08g37874:12008.t03523:unspliced-genomic oxidoreductase, putative, expressed| Length = 8492 Score = 29.5 bits (58), Expect = 7.4 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = -3 / +2 Query: 125 DTHRRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 D R P A + AR R RA W + A CRRR Sbjct: 164 DAVRHLLKPAASTSSPARLLGSARWGGRASWGSTTALCRRR 286
>LOC_Os08g13060:12008.t01184:unspliced-genomic ATBPM1, putative, expressed| Length = 1504 Score = 29.5 bits (58), Expect = 7.4 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -3 / -3 Query: 80 AARFTWPWRRSKRAGWARSRASCRRR 3 A R P RR RAGWAR R + RR Sbjct: 452 AGRRA*PRRRPTRAGWARRRGA*GRR 375
>LOC_Os08g02850:12008.t00179:unspliced-genomic ubiquitin-protein ligase/ zinc ion binding protein, putative,| expressed Length = 2900 Score = 29.5 bits (58), Expect = 7.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 / +2 Query: 74 RFTWPWRRSKRAGWARSRASCR 9 R+ WPW +S+ AG+A R Sbjct: 1958 RYLWPWMKSQEAGFAHCALRAR 2023
>LOC_Os07g47990:12007.t04433:unspliced-genomic peroxidase 2 precursor, putative, expressed| Length = 1710 Score = 29.5 bits (58), Expect = 7.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 / -2 Query: 62 PWRRSKRAGWARSRASCRRR 3 PWRR++R GW R R R Sbjct: 941 PWRRTRR*GWRRRRTEVAGR 882
>LOC_Os07g41560:12007.t03811:unspliced-genomic STF-1, putative| Length = 535 Score = 29.5 bits (58), Expect = 7.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 / +2 Query: 56 RRSKRAGWARSRASCRRR 3 RRS W RSRA C RR Sbjct: 80 RRSTATSWRRSRAGCTRR 133
>LOC_Os07g34620:12007.t03137:unspliced-genomic expressed protein| Length = 2279 Score = 29.5 bits (58), Expect = 7.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 / +3 Query: 74 RFTWPWRRSKRAGWARSRAS 15 R+TW RS+ GWAR+R S Sbjct: 1761 RWTWRRGRSRCRGWARARCS 1820
>LOC_Os07g11060:12007.t00980:unspliced-genomic expressed protein| Length = 7514 Score = 29.5 bits (58), Expect = 7.4 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = -3 / -2 Query: 119 HRRTHMPGADDVTAARFTWPWRRSKRAGWARSRASCRR 6 H H+ R P RR +R W R R CRR Sbjct: 292 HLHLHLHRPSHPRHRRGERPRRRRRRGAWRRRRGRCRR 179
>LOC_Os07g01310:12007.t00030:unspliced-genomic glutamate receptor 3.4 precursor, putative, expressed| Length = 5462 Score = 29.5 bits (58), Expect = 7.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 / -2 Query: 59 WRRSKRAGWARSRASCRRR 3 WRR +R W+R R + RRR Sbjct: 3214 WRRRRRRRWSRRRGAGRRR 3158
>LOC_Os06g30820:12006.t02785:unspliced-genomic expressed protein| Length = 3045 Score = 29.5 bits (58), Expect = 7.4 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -3 / +1 Query: 92 DDVTAARFTWPWRRSKRAGWARSRASCRRR 3 DD AA T RR +R GW R R RRR Sbjct: 115 DDEWAATTTSGRRRRRRRGWWRRRRPRRRR 204
>LOC_Os06g21920:12006.t02008:unspliced-genomic inorganic phosphate transporter 1-9, putative, expressed| Length = 1214 Score = 29.5 bits (58), Expect = 7.4 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 / +3 Query: 56 RRSKRAGWARSRASCRRR 3 RR R W R+RA+CRRR Sbjct: 948 RRR*RGRWRRTRAACRRR 1001
>LOC_Os06g08110:12006.t00693:unspliced-genomic nodulin-like protein, putative, expressed| Length = 3191 Score = 29.5 bits (58), Expect = 7.4 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 / -3 Query: 56 RRSKRAGWARSRASCRRR 3 RR +RA W+RSR RRR Sbjct: 384 RRRRRARWSRSRGGMRRR 331
>LOC_Os05g51230:12005.t04551:unspliced-genomic phosphatidylinositol 3- and 4-kinase family protein, expressed| Length = 2452 Score = 29.5 bits (58), Expect = 7.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 / -3 Query: 59 WRRSKRAGWARSRASCRRR 3 WR RAG R R SCRRR Sbjct: 887 WRSGGRAGG*RRRRSCRRR 831
>LOC_Os05g16750:12005.t01445:unspliced-genomic hypothetical protein| Length = 738 Score = 29.5 bits (58), Expect = 7.4 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 / +2 Query: 68 TWPWRRSKRAGWARSRASCRRR 3 TW WR S++ W R CR R Sbjct: 572 TWRWRWSQQRCWRRRHTPCRWR 637
>LOC_Os05g11160:12005.t00948:unspliced-genomic expressed protein| Length = 1491 Score = 29.5 bits (58), Expect = 7.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 / -2 Query: 143 TQ*KDSDTHRRTHMPGADDVTAARFTWPWRRSKR 42 ++*+ + HRR PG+ +A WP RR +R Sbjct: 995 SR*RGAAGHRRGFAPGSTPPSATESRWPSRRRRR 894
>LOC_Os05g03972:12005.t00294:unspliced-genomic expressed protein| Length = 6147 Score = 29.5 bits (58), Expect = 7.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / -1 Query: 59 WRRSKRAGWARSRASCRRR 3 W R +RAG R R CRRR Sbjct: 5016 WWRCRRAGGGRGRRLCRRR 4960
>LOC_Os04g43800:12004.t03920:unspliced-genomic phenylalanine ammonia-lyase, putative, expressed| Length = 2745 Score = 29.5 bits (58), Expect = 7.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 / -1 Query: 62 PWRRSKRAGWARSRASCRR 6 PWR AG RSRA CRR Sbjct: 999 PWRGLPWAGARRSRAGCRR 943
>LOC_Os04g08200:12004.t00691:unspliced-genomic conserved hypothetical protein| Length = 2226 Score = 29.5 bits (58), Expect = 7.4 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 / -3 Query: 83 TAARFTWPWRRSKRAGWARSRASC 12 +++R TWP RR A RSR SC Sbjct: 511 SSSRCTWPRRRRASARTPRSRPSC 440
>LOC_Os03g51880:12003.t04516:unspliced-genomic expressed protein| Length = 2228 Score = 29.5 bits (58), Expect = 7.4 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 / -2 Query: 98 GADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 G DD+ R ++ WRR +G AR + RRR Sbjct: 301 G*DDLHLPRESFHWRRRTSSGLARKGSGSRRR 206
>LOC_Os02g53169:12002.t005593:unspliced-genomic expressed protein| Length = 1463 Score = 29.5 bits (58), Expect = 7.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 / +3 Query: 59 WRRSKRAGWARSRASCR 9 W ++ RAGW+R SCR Sbjct: 789 WAKAHRAGWSRG*GSCR 839
>LOC_Os02g32310:12002.t02874:unspliced-genomic hypothetical protein| Length = 414 Score = 29.5 bits (58), Expect = 7.4 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -3 / +2 Query: 95 ADDVTAARFTWPWRRSKRAGWARSRASCRRR 3 +D TA R P R R+GW S A RRR Sbjct: 221 SDTATATRSRRPAARGGRSGWCGSPARRRRR 313
>LOC_Os01g72610:12001.t06549:unspliced-genomic glycosyltransferase, putative, expressed| Length = 2022 Score = 29.5 bits (58), Expect = 7.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / +3 Query: 59 WRRSKRAGWARSRASCRRR 3 W RS+R W RSRA RR Sbjct: 1383 WCRSRRWAWRRSRAGATRR 1439
>LOC_Os01g52830:12001.t04709:unspliced-genomic secreted protein, putative, expressed| Length = 1541 Score = 29.5 bits (58), Expect = 7.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 / +3 Query: 59 WRRSKRAGWARSRASCRRR 3 W + R WAR R+ CRRR Sbjct: 645 WTAATRCPWARRRSWCRRR 701
>LOC_Os01g50730:12001.t04507:unspliced-genomic conserved hypothetical protein| Length = 2414 Score = 29.5 bits (58), Expect = 7.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 / +2 Query: 59 WRRSKRAGWARSRASCR 9 W ++ RAGW+R SCR Sbjct: 719 WAKAHRAGWSRG*GSCR 769
>LOC_Os01g28030:12001.t02502:unspliced-genomic peroxidase 24 precursor, putative, expressed| Length = 3993 Score = 29.5 bits (58), Expect = 7.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 / -2 Query: 62 PWRRSKRAGWARSR 21 PWRRS R GW R R Sbjct: 1313 PWRRSWRGGWGRWR 1272
>LOC_Os07g05520:12007.t00435:unspliced-genomic hypothetical protein| Length = 2420 Score = 29.5 bits (58), Expect = 7.5 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -1 / -3 Query: 151 YSTHNERTQTHTDEHT 104 Y+TH++RT+TH +HT Sbjct: 1743 YNTHSQRTRTHPYKHT 1696
>LOC_Os06g04190:12006.t00308:unspliced-genomic rad1-like protein, putative, expressed| Length = 6520 Score = 29.5 bits (58), Expect = 7.5 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -1 / -2 Query: 133 RTQTHTDEHTCQEQTMSRPHGSLGLGGDPSEQG 35 R +EHTC++ + S+ +G PS G Sbjct: 5844 RAMDEEEEHTCRQDCRRKTKASMNVGPTPSPNG 5746
>LOC_Os05g39930:12005.t03533:unspliced-genomic spotted leaf protein 11, putative, expressed| Length = 2633 Score = 29.5 bits (58), Expect = 7.5 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 / -2 Query: 73 RAAVTSSAPGMCVRLCVSESFHCVLNKCTTCSVS 174 RAA +S+ +RL +S LN+C+T S S Sbjct: 436 RAATSSACSSSRIRLRAEQSATTALNRCSTSSTS 335
>LOC_Os02g55010:12002.t05078:unspliced-genomic expressed protein| Length = 5922 Score = 29.5 bits (58), Expect = 7.5 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = -2 / +3 Query: 195 QHRLPMVGHTACGTFIQHTMKGLRHTQTNTHARSRRCHGRTVHLALEAIQASR 37 QHR P+VG A +R AR R H V L +QA R Sbjct: 105 QHRPPLVGRAAAVVRAPAGAAAVRRRPRRLRARPHRRHRDPVGALLRRVQAPR 263
>LOC_Os06g03980:12006.t00289:unspliced-genomic expressed protein| Length = 6520 Score = 27.2 bits (53), Expect(2) = 7.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 / -1 Query: 62 PWRRSKRAGWARSRASCRRR 3 P RR +R W R RA RRR Sbjct: 190 PLRRRRRTTWTRRRAYPRRR 131 Score = 22.6 bits (43), Expect(2) = 7.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -1 / -3 Query: 208 QQNYSASFAHGRTHCM 161 Q ++ S GRTHC+ Sbjct: 593 QTSFLGSIMQGRTHCI 546
>LOC_Os03g20600:12003.t01816:unspliced-genomic expressed protein| Length = 774 Score = 23.5 bits (45), Expect(2) = 8.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 / -3 Query: 53 RSKRAGWARSRASCRRR 3 RS A WAR+R RRR Sbjct: 379 RSPGAWWARTRTPGRRR 329 Score = 22.1 bits (42), Expect(2) = 8.4 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 / -3 Query: 156 TFIQHTMKGLRHTQ 115 TF++ TMK ++H Q Sbjct: 583 TFVRTTMKFIKHAQ 542
>LOC_Os04g10460:12004.t00880:unspliced-genomic amidase, putative, expressed| Length = 3005 Score = 24.9 bits (48), Expect(2) = 9.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 / -2 Query: 59 WRRSKRAGWARSRASCRRR 3 W R R+ W RS +S RRR Sbjct: 79 WPR*TRSQWRRSSSSRRRR 23 Score = 23.5 bits (45), Expect(2) = 9.5 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = -1 / -1 Query: 196 SASFAHGRTHCMWYIYSTHNERTQTHTDEHTCQEQTMSRPHGSLG 62 SAS TH Y H+ RTQ C+ S H S G Sbjct: 2645 SASVHSPSTHRSRYQMVLHDHRTQPAR*SRACRRWQKS*MHESWG 2511 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 105,679,557 Number of extensions: 1423355 Number of successful extensions: 15688 Number of sequences better than 10.0: 219 Length of query: 98 Length of database: 55,613,886 Length adjustment: 45 Effective length of query: 53 Effective length of database: 53,081,376 Effective search space: 2813312928 Effective search space used: 2813312928 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
