Clone Name | FLbaf65l02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Q84L31:RD23C_ARATH Putative DNA repair protein RAD23-3 - Arabido... | 31 | 5.5 | 2 | O83943:LSPA_TREPA Lipoprotein signal peptidase - Treponema pallidum | 30 | 9.4 |
---|
>Q84L31:RD23C_ARATH Putative DNA repair protein RAD23-3 - Arabidopsis thaliana| (Mouse-ear cress) Length = 419 Score = 31.2 bits (69), Expect = 5.5 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 6/70 (8%) Frame = -3 Query: 498 PAMRAPMTWLQ*PCT-SSQIGSHPACELPFLPTSAIAPVAATAPVST-----IPITTSVM 337 P+ P Q P + S+ + P P PT APVAAT V+T +P T S Sbjct: 99 PSTSQPSISPQTPASVSAPVAPAPTRPPPPAPTPTPAPVAATETVTTPIPEPVPATISSS 158 Query: 336 TSSLEAAPPG 307 T + ++AP G Sbjct: 159 TPAPDSAPVG 168
>O83943:LSPA_TREPA Lipoprotein signal peptidase - Treponema pallidum| Length = 186 Score = 30.4 bits (67), Expect = 9.4 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 470 NQVMGALIAGFVALVVYFLIIMHSLHAVTDTMCP 571 NQV+ L+ G V L++ FLI+ TD CP Sbjct: 68 NQVLRTLVLGIVPLIIMFLIVFSYFR--TDAFCP 99 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 129,119,978 Number of extensions: 2629774 Number of successful extensions: 6970 Number of sequences better than 10.0: 2 Number of HSP's gapped: 6956 Number of HSP's successfully gapped: 2 Length of query: 285 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 173 Effective length of database: 69,965,399 Effective search space: 12104014027 Effective search space used: 12104014027 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)