Clone Name | rbags14a23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATM_EMENI (Q5BHE2) Serine/threonine-protein kinase tel1 (EC 2.7.... | 30 | 6.1 | 2 | NARW_ECOLI (P19317) Respiratory nitrate reductase 2 delta chain ... | 30 | 8.0 |
---|
>ATM_EMENI (Q5BHE2) Serine/threonine-protein kinase tel1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase tel1) (Telomere length regulation protein 1) (ATM homolog) Length = 2793 Score = 30.4 bits (67), Expect = 6.1 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = -1 Query: 497 QNWDKVRKFVMYTWGPSNLDPTDRSGKWPEASMMDSLHGSFHKKRKPTRRATSIATRTMR 318 + W+ V KF + N + +S P +S+MD G+ + P+R S+A R Sbjct: 155 EEWESVLKFCLKVVNVRNDHNSQQSTWSPHSSVMDDYIGASGGRSTPSRMTPSLAVREKP 214 Query: 317 EHP 309 + P Sbjct: 215 KGP 217
>NARW_ECOLI (P19317) Respiratory nitrate reductase 2 delta chain (EC 1.7.99.4)| Length = 231 Score = 30.0 bits (66), Expect = 8.0 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = -1 Query: 743 CRTLPMEY*TLPLYISYLSDYIVEISNESVLGPVSIIASIGG 618 CR LP +Y LPLY+ YLS + + E +L I+A +GG Sbjct: 100 CRELP-DY--LPLYLEYLSVLPDDQAKEGLLNVAPILALLGG 138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 108,368,028 Number of Sequences: 219361 Number of extensions: 2231173 Number of successful extensions: 5150 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5135 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7876239983 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)