Clone Name | rbaal26g22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GUN1_ACICE (P54583) Endoglucanase E1 precursor (EC 3.2.1.4) (End... | 31 | 3.7 | 2 | PLEC1_RAT (P30427) Plectin-1 (PLTN) (PCN) | 30 | 8.2 | 3 | SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouc... | 30 | 8.2 | 4 | S27A5_MOUSE (Q4LDG0) Bile acyl-CoA synthetase (EC 6.2.1.7) (BACS... | 30 | 8.2 |
---|
>GUN1_ACICE (P54583) Endoglucanase E1 precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase E1) (Cellulase E1) (Endocellulase E1) Length = 562 Score = 30.8 bits (68), Expect = 3.7 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = -3 Query: 576 NSFGLKASVAESLTLAMKPWKFEQSVHGN-TATLNWFLHDGMNGREVCASKPSKLSLLQP 400 N F + +V S ++A K W + GN T T +W NG+ V A S +++QP Sbjct: 477 NGFTVTVAVTNSGSVATKTWTVSWTFGGNQTITNSWNAAVTQNGQSVTARNMSYNNVIQP 536
>PLEC1_RAT (P30427) Plectin-1 (PLTN) (PCN)| Length = 4687 Score = 29.6 bits (65), Expect = 8.2 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Frame = -2 Query: 505 VCARKHCNLELVSARRHERKGGLCFKAFQAFAASAE----GLVPRQVLE 371 + K + + HERKG LCF+ +A +AE G++ +V + Sbjct: 3090 ITVEKIIKIVITVVEEHERKGQLCFEGLRALVPAAELLDSGVISHEVYQ 3138
>SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouch) (Homeobox| protein NK-1) Length = 659 Score = 29.6 bits (65), Expect = 8.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 545 SATEALRPNEFGGSNEPSMPFSRPNSW 625 S L PN+F G+ PS PF P W Sbjct: 448 SVENILDPNKFTGNKLPSGPFGHPRQW 474
>S27A5_MOUSE (Q4LDG0) Bile acyl-CoA synthetase (EC 6.2.1.7) (BACS) (Bile acid| CoA ligase) (BA-CoA ligase) (BAL) (Cholate--CoA ligase) (Very long chain acyl-CoA synthetase-related protein) (VLACS-related) (VLACSR) (Fatty acid transport protein 5) (FATP-5) Length = 689 Score = 29.6 bits (65), Expect = 8.2 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = -3 Query: 567 GLKASVAESLTLAMKP---WKFEQSVHGNTATLNWFLHDGMNGREVC 436 GL+A+V ++ P W+F S GN +N+ H G GR C Sbjct: 409 GLRANVWKNFQQRFGPIRIWEFYGSTEGNVGLMNYVGHCGAVGRTSC 455 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,619,690 Number of Sequences: 219361 Number of extensions: 2046588 Number of successful extensions: 5287 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5286 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)