Clone Name | bags14a23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ARP2_PLAFA (P13824) Clustered-asparagine-rich protein (CARP) | 33 | 1.0 | 2 | OSP_DROME (Q27421) Protein outspread | 30 | 5.0 |
---|
>ARP2_PLAFA (P13824) Clustered-asparagine-rich protein (CARP)| Length = 443 Score = 32.7 bits (73), Expect = 1.0 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +3 Query: 333 LNASLQNPT-DGVLNTTLYISYLSDYIVEISNESVLGPVSIIASI 464 +N + N T DGVLNT L+I + +I ++ S+LG V I I Sbjct: 1 MNNEIVNSTIDGVLNTKLHIQNIPPHITDVHLRSLLGNVGFIKDI 45
>OSP_DROME (Q27421) Protein outspread| Length = 1553 Score = 30.4 bits (67), Expect = 5.0 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 9/53 (16%) Frame = +1 Query: 163 TLTTMVMRSSRHSEGQTPTCS---------RFSCFPRYTTNLIT*SSCSHCFR 294 T+TT V + S TPT + R + ++T N+ S CSHCFR Sbjct: 5 TITTTVPAAPSKSAPPTPTTTGAAGATTNARTADCRKFTPNIFNKSKCSHCFR 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,606,209 Number of Sequences: 219361 Number of extensions: 1707397 Number of successful extensions: 4121 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4120 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6427774254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)