Clone Name | basd20f23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RPOC_THEMA (P36252) DNA-directed RNA polymerase beta' chain (EC ... | 31 | 1.4 | 2 | KPRS_COREF (Q8FQV2) Ribose-phosphate pyrophosphokinase (EC 2.7.6... | 30 | 4.2 | 3 | THRB_RAT (P18292) Prothrombin precursor (EC 3.4.21.5) (Coagulati... | 29 | 7.2 | 4 | Y4168_BRUSU (Q8FUQ2) UPF0261 protein BRA1168 | 28 | 9.4 |
---|
>RPOC_THEMA (P36252) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1690 Score = 31.2 bits (69), Expect = 1.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +3 Query: 24 VTVLLYQAIKRRNIEVHRVKPANAPDLLAFVNDIEFHITTISSMSCS 164 + L+Y+ KR I+ A DLL + DI FH T+S ++ S Sbjct: 888 INALVYETFKRHGID-------RAADLLDDIKDIGFHYATVSGLTLS 927
>KPRS_COREF (Q8FQV2) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 325 Score = 29.6 bits (65), Expect = 4.2 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +3 Query: 144 ISSMSCSQVVKPSTIAMGTPGFMDFRVLPLSTLLTYSCQNTSQGPSITLKCSG 302 +SS +V+ T+ T G+ + VLP++ LL + + S+T G Sbjct: 271 LSSCGAEEVITTDTLPQSTEGWSNLTVLPIAPLLARTISEIFENGSVTTLFEG 323
>THRB_RAT (P18292) Prothrombin precursor (EC 3.4.21.5) (Coagulation factor| II) [Contains: Activation peptide fragment 1; Activation peptide fragment 2; Thrombin light chain; Thrombin heavy chain] Length = 617 Score = 28.9 bits (63), Expect = 7.2 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = +3 Query: 225 LPLSTLLTYSCQNTSQGPSITLKCSGCRMPPRDHYVSWQFVDLPRQPALAVGFQF---NL 395 LP TL Y QN P + L + CR P RD +W FV +QP GF++ N Sbjct: 242 LPTKTLSKY--QNFD--PEVKLVQNFCRNPDRDEEGAWCFV--AQQP----GFEYCSLNY 291 Query: 396 TTKQTGDDEH 425 + G++ H Sbjct: 292 CDEAVGEENH 301
>Y4168_BRUSU (Q8FUQ2) UPF0261 protein BRA1168| Length = 418 Score = 28.5 bits (62), Expect = 9.4 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 302 AAALERDRRPLARVLATVGQERRERQHPEVHE 207 AA LER P+A +L T G + R+R +HE Sbjct: 331 AAKLERAAAPVAFILPTGGVQERDRNGEPLHE 362 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,865,115 Number of Sequences: 219361 Number of extensions: 1164934 Number of successful extensions: 3603 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3603 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)